KEGG   Loxodonta africana (African savanna elephant): 100670991
Entry
100670991         CDS       T04351                                 

Gene name
TNNT2
Definition
(RefSeq) troponin T, cardiac muscle
  KO
K12045  troponin T, cardiac muscle
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100670991 (TNNT2)
   04261 Adrenergic signaling in cardiomyocytes
    100670991 (TNNT2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100670991 (TNNT2)
   05414 Dilated cardiomyopathy
    100670991 (TNNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100670991 (TNNT2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     100670991 (TNNT2)
SSDB
Motif
Pfam: Troponin
Other DBs
NCBI-GeneID: 100670991
NCBI-ProteinID: XP_003410262
LinkDB
Position
Unknown
AA seq 297 aa
MSDAEDAVEEYEEEQEAEEAVEEQEEAVEEEAEGEAEAEEAEIEEIRAKEDEQEDEAKEA
EDGQVEESKPKPRLFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQTLIEAHFENRKK
EEEELISLKDRIEKRRAERAEQQRIRNEREKERQTRLAEERARREEEENRRKAEDEARKK
KALSNMMHFGGYIQKVRRRAAATERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLRE
KAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTCGKAKVTGRWK
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtctgacgcagaagacgccgtggaagagtacgaagaggagcaggaagcagaagaagct
gtggaagagcaggaggaggcagtggaagaagaggctgaaggggaagctgaggctgaggag
gctgagattgaggagattagggcaaaagaagatgaacaagaagatgaggctaaagaggct
gaagatggccaggtggaggagtccaaacccaagcccaggctattcatgcccaacttggtg
ccacccaagatccctgatggagagcgggtagactttgatgacatccaccggaagcgcatg
gagaaggacctgaacgagctgcagacgctgatcgaggctcactttgagaacaggaagaag
gaggaagaggagctcatttcgctcaaagacaggatcgagaagcggcgggcagagcgtgca
gagcagcagcgcatccggaatgagcgtgagaaggaacgtcagactcgcctggctgaagag
agggcccggcgagaggaggaggagaacaggaggaaggctgaggatgaggcccggaagaag
aaggctttgtccaacatgatgcattttggaggatatatccagaaggtacgcaggagagca
gcagcaacggagaggaagagtgggaagaggcagacagagcgggagaagaaaaagaagatt
ctggctgagaggaggaaggtgctggccatcgaccacctgaatgaagatcagctgagagag
aaggccaaggaactgtggcagagcatctataacctggaggcggagaaatttgacctgcag
gagaagttcaagcagcagaaatatgaaatcaacgttctccgaaacaggatcaatgataac
cagaaagtctccaagacctgtgggaaggccaaagtcactgggcgctggaagtag

DBGET integrated database retrieval system