KEGG   Loxodonta africana (African savanna elephant): 100671131
Entry
100671131         CDS       T04351                                 

Gene name
MMP14
Definition
(RefSeq) matrix metalloproteinase-14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04668  TNF signaling pathway
lav04912  GnRH signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100671131 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100671131 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    100671131 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100671131 (MMP14)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     100671131 (MMP14)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100671131 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 DUF4953 Metallopep HTH_17 Peptidase_M66 Reprolysin_3 Reprolysin_5 SKG6
Other DBs
NCBI-GeneID: 100671131
NCBI-ProteinID: XP_010598801
UniProt: G3SQ16
LinkDB
Position
Unknown
AA seq 583 aa
MSPAPRPARRLLLPLLTLGTVLASLDLAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLHFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSQSGSPTKIPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSSGGRPDQGTEEETEVIIIEVDEEGSGAVSA
AAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtctcccgccccacgacccgctcgcaggctgctgcttcccctgctcacgctcggcacg
gtgctcgcctccctcgacttggcccaaagcagcagcttcagccccgaagcctggctacag
cagtatggctacctgccccctggggacctgcgtactcacacacagcgctcacctcagtca
ctctcagctgccatcgctgccatgcagaagttctatggtttgcgagtgacaggcaaagct
gatgcagacaccatgaaggccatgaggcgtccccgctgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctatgccatccagggcctcaaatggcaa
cataatgagattactttctgcatccagaattacacccccaaggtgggcgagtatgccaca
ttcgaggccattcgcaaggcattccgcgtatgggagagtgccacacctctgcacttccgt
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagcacgcccttcgatggcgagggcggcttcctggcc
cacgcctacttcccaggccccaacattggaggggacactcactttgactctgctgagccc
tggactgtccggaatgaggatcttaatgggaatgacatcttcctggtggctgtgcatgag
ctgggccatgccctgggcctcgagcattccaatgacccctcagccatcatggcacccttt
taccagtggatggacacagagaactttgtgctgcctgacgatgaccgccggggcatccag
caactttatgggagtcagtcagggtcccccaccaagatcccccctcaacccaggacaacc
tcccggccctctgtccctgataagcccaaaaaccccacctatgggcccaacatctgtgac
gggaacttcgacactgtggccgtgctccgaggggagatgtttgtcttcaaggagcgttgg
ttttggcgggtgaggaataaccaagtgatggatggttacccaatgcccatcggccagttc
tggcggggcttgcctgcatctatcaacactgcctacgagaggaaggatggcaagtttgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcatccctggaacctggctacccc
aagcacattaaggagctgggccgtggactgcctactgacaagattgatgctgccctcttt
tggatgcccaacgggaagacctacttcttccggggaaacaagtactaccgtttcaatgag
gagctcagggcagtggacagcgagtaccccaaaaacatcaaagtctgggaaggaatccct
gagtcacccagagggtcattcatgggcagcgacgaagtcttcacttatttctacaagggg
aacaaatactggaaattcaacaaccagaagctaaaggtggagccaggctaccccaagtca
gccctgcgggactggatgggctgcccatcgtctgggggccggccagatcaggggactgag
gaggagacggaggtgatcatcatcgaggtggacgaggagggcagtggggcagtgagcgca
gccgctgtggtgctgcctgtgctgctgctgcttctggtgctggcagtgggcctcgctgtc
ttcttcttcagacgccatgggactcccaagcgactgctctattgccagcgctccctgctg
gacaaagtctga

DBGET integrated database retrieval system