KEGG   Loxodonta africana (African savanna elephant): 100671185
Entry
100671185         CDS       T04351                                 

Gene name
KCNJ11
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 11 isoform X1
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100671185 (KCNJ11)
   04929 GnRH secretion
    100671185 (KCNJ11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100671185 (KCNJ11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100671185 (KCNJ11)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100671185 (KCNJ11)
SSDB
Motif
Pfam: IRK_C IRK EI24 Ion_trans_2
Other DBs
NCBI-GeneID: 100671185
NCBI-ProteinID: XP_003412035
UniProt: G3UMC8
LinkDB
Position
Unknown
AA seq 390 aa
MLSRKGIIPEEYVLTRLAEDPAEPRYHARERRARFVSKNGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPGEGGPVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILVLIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIAVRQGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIVVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALP
LASARGPLRKRSMAVAKAKPKFSISPDALS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctgtcccgcaagggcatcattcccgaggagtatgtgctgactcggctcgcggaggac
cctgcagagccccggtaccatgcccgtgaaaggagggcccgcttcgtgtccaagaacggc
aactgcaacgtggcccacaagaacatccgtgagcagggccgcttcctgcaggacgtgttc
accaccctggtggacctcaagtggccccacacccttctcatcttcaccatgtccttcttg
tgcagctggttgctcttcgccatggcctggtggctcattgccttcgcgcacggtgacctg
gcccccggcgagggcggcccagtgccctgtgtcaccagcatccactccttctcatcggcc
ttccttttctccatcgaggttcaggtgaccatcggttttggtggacgcatggtgactgag
gagtgcccactggccatcctggtcctcattgtacagaacatcgtggggctcatgatcaat
gccatcatgctgggctgcatcttcatgaagactgcccaggcccaccggcgggcagagact
cttatcttcagcaaacatgcagtcatcgcagtacgccagggccgcctctgcttcatgctg
cgtgtgggcgacctccgcaagagcatgatcatcagcgccaccatccacatgcaggtggtg
cgcaagaccaccagccctgagggtgaagtagtgcccctccaccaggtggacatccccatg
gagaacggtgtggggggcaacagcatcttcctggtggcccccctcattatctaccacgtc
attgatgccaacagcccactctatgacctggcacccagtgacctgcaccaccaccaggac
ctcgagatcgttgtcatccttgaaggcgtggtggaaaccacaggcatcaccacccaggcc
cgcacctcctacctggctgatgagattctgtggggccagcgctttgtgcccattgtagcc
gaggaggacggccgctactctgtggactactccaagtttggcaacaccatcaaagtgccc
acgccactctgcacagcccgtcagcttgatgaggaccgaagcctgctggacgccctgccc
cttgcctcagcccgtgggcccctgcgcaagcgcagcatggcagtggctaaagccaagccc
aagtttagcatctctccggatgctctgtcctga

DBGET integrated database retrieval system