KEGG   Loxodonta africana (African savanna elephant): 100671462
Entry
100671462         CDS       T04351                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb isoform X1
  KO
K07208  Ras homolog enriched in brain
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04218  Cellular senescence
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100671462 (RHEB)
   04151 PI3K-Akt signaling pathway
    100671462 (RHEB)
   04152 AMPK signaling pathway
    100671462 (RHEB)
   04150 mTOR signaling pathway
    100671462 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100671462 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    100671462 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100671462 (RHEB)
   04919 Thyroid hormone signaling pathway
    100671462 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    100671462 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100671462 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100671462 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100671462 (RHEB)
   05163 Human cytomegalovirus infection
    100671462 (RHEB)
   05165 Human papillomavirus infection
    100671462 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:lav04031]
    100671462 (RHEB)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    100671462 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 100671462
NCBI-ProteinID: XP_010588386
UniProt: G3SM68
LinkDB
Position
Unknown
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgccatcctgggctaccggtctgtggggaaatcc
tcattgacaattcaatttgttgaaggccaatttgttgattcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagctgggcaggatgaatattccatcttccctcagacatactctatagatattaatggt
tatatccttgtgtactctgttacatcaatcaaaagttttgaagtgattaaagttatccac
ggcaaattgttggatatggtggggaaagttcaaatacctattatgttggtgggaaataag
aaagacctacatatggaaagggtgatcagttatgaagaagggaaagctttagcagaatct
tggaatgctgcttttttggaatcttctgctaaagaaaatcagactgctgtggatgttttt
agaaggataattttggaggcagaaaaaattgacggggcagcttcacaaggaaagtcttca
tgctcagtgatgtaa

DBGET integrated database retrieval system