KEGG   Loxodonta africana (African savanna elephant): 100671471
Entry
100671471         CDS       T04351                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04064  NF-kappa B signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav04140  Autophagy - animal
lav04144  Endocytosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04722  Neurotrophin signaling pathway
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100671471 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100671471 (TRAF6)
   04064 NF-kappa B signaling pathway
    100671471 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100671471 (TRAF6)
   04140 Autophagy - animal
    100671471 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100671471 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100671471 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100671471 (TRAF6)
   04657 IL-17 signaling pathway
    100671471 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100671471 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100671471 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671471 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100671471 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100671471 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100671471 (TRAF6)
   05135 Yersinia infection
    100671471 (TRAF6)
   05133 Pertussis
    100671471 (TRAF6)
   05152 Tuberculosis
    100671471 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100671471 (TRAF6)
   05161 Hepatitis B
    100671471 (TRAF6)
   05160 Hepatitis C
    100671471 (TRAF6)
   05171 Coronavirus disease - COVID-19
    100671471 (TRAF6)
   05162 Measles
    100671471 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100671471 (TRAF6)
   05169 Epstein-Barr virus infection
    100671471 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100671471 (TRAF6)
   05140 Leishmaniasis
    100671471 (TRAF6)
   05142 Chagas disease
    100671471 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100671471 (TRAF6)
   04121 Ubiquitin system [BR:lav04121]
    100671471 (TRAF6)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100671471 (TRAF6)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100671471 (TRAF6)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100671471 (TRAF6)
SSDB
Motif
Pfam: TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 Tropomyosin_1 U-box SlyX zf-RING_11 zf-TRAF DUF3450 DUF16 ATG16 Tropomyosin PspA_IM30 Spc29 CENP-F_leu_zip AAA_13
Other DBs
NCBI-GeneID: 100671471
NCBI-ProteinID: XP_023406685
LinkDB
Position
Unknown
AA seq 516 aa
MSLLNCENSCGSSQPDGDCCAAMASSCSATTKDDSVSGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLKVKCPNAGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKCHLNIHVLK
ECPRRQVSCVNCAILMAFEDKEIHDQNCPLANVICEYCNTMLIREQVMQRNHLARHLQEN
TQSHMRMLAQAVQNLSLALTPRPQCDMLPYDSASLSRVSSGCHPEVQNFQETIQQLEGRL
VRQDHQIRELTAKMETQSMYVGELKRTIRTLEDRIAEIEAQECNGIYIWKIGNFGMHLKC
QEEEKPVVIHSPGFYTGKPGYKMCLRLHIQLPNAQRCANYISLFVHTMQGEYDSHLPWPF
QGTIRLAILDQSETPVRQNHEEIMDTKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRT
FVKDDTLLVRCEVYSRFDMGSLRREAFQPRSTDAGV
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagcctgacggtgactgttgt
gctgccatggccagctcctgtagtgccacaaccaaagatgacagtgtgagtgggacagcc
agcacagggaacctctccagttcctttatggaagagatccaggggtatgatgtggagttt
gacccacccctggaaagcaagtatgaatgccccatctgtctgatggcattgcgggaagca
gtgcaaacaccatgtggccacagattctgcaaagcctgcatcaccaaatcgataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggagaatcagctatttcctgat
aattttgcaaaacgagagattctttctctgaaggtgaagtgtccaaatgcaggttgtttg
cacaagatggagctgaggcatctagaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccaacgtcccttccaaaaatgccatcttaatattcacgttctcaag
gagtgtccaaggaggcaggtttcctgtgtgaactgtgctatattaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatacc
atgctcatcagagaacaggtaatgcagaggaatcacttggcacgccacctgcaagagaac
acccagtcgcacatgagaatgttggcccaggcggttcagaatttaagccttgctttaact
cccaggcctcagtgtgacatgcttccgtatgattctgcctctctgtcccgagtgtcctcc
ggatgtcacccagaggtccagaacttccaagaaaccattcagcagttagaaggtcgcctc
gtcagacaagaccatcaaatccgggagctgactgctaaaatggaaactcagagcatgtac
gtaggtgagctcaaacgaaccattcgaacccttgaggacagaattgctgaaatagaagca
caggagtgcaatgggatttacatctggaagattggcaactttgggatgcacttgaaatgc
caagaagaggagaaacccgttgtcattcacagccccggattctacactggcaaacccggc
tataagatgtgcttgcgcctgcacattcagctgccaaacgcccagcgctgtgcaaactac
atctccctctttgtccacacaatgcaaggagagtatgacagccacctgccctggcccttc
cagggtacaatacgccttgcaattctagatcagtccgaaacacctgtaaggcaaaaccac
gaagagatcatggataccaaaccagagctgcttgccttccagcgacccacaatcccacgg
aacccaaaggggtttggctatgtaacttttatgcacctagaagcgctaagacaaagaacc
ttcgttaaggatgataccttactagtgcgctgtgaggtctatagccgcttcgacatgggt
agccttcggagggaggcctttcagccacgaagtactgatgcaggggtatag

DBGET integrated database retrieval system