KEGG   Loxodonta africana (African savanna elephant): 100671507
Entry
100671507         CDS       T04351                                 

Gene name
SLC1A1
Definition
(RefSeq) excitatory amino acid transporter 3
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04724  Glutamatergic synapse
lav04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100671507 (SLC1A1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100671507 (SLC1A1)
   04721 Synaptic vesicle cycle
    100671507 (SLC1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100671507 (SLC1A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   100671507 (SLC1A1)
SSDB
Motif
Pfam: SDF RAB3GAP2_C
Other DBs
NCBI-GeneID: 100671507
NCBI-ProteinID: XP_023395195
LinkDB
Position
Unknown
AA seq 465 aa
MRMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYLCTTIIAVILGIVLVVSIKPG
VSQKVDEIDRVGSTPDVSTVDSMLDLIRNMFPENLVQACFQQYKTRREEVNPAGEPEMNM
TEDSVTAAMTTTVSKNKTKEYTVVGLYSDGMNVLGLIVFCLVFGIVIGKMGERGQILVDF
FNALNDATMQIVQTIMCYMPLGILFLIAGKIIEVEDWEVFRKLGLYMATVLSGLAIHSII
ILPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPITLCCAEEKNLVDRRITRFVL
PVGATINMDGGALYEAVATVFIAQLNNLDLGIGQIVTICVAATASSIGAAGVPQAGLVTM
VIVLSAVGLPAEDVTLIIAVDWLLDRFRTVVNVLGDAFGTGIVEKLSKKELEQMDASSEV
NIVNPFALESTILDNEDPETKKSYVNGGFAVDKSDAISFTQTSQF
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaggatgctgaagctcatcattttgccattgattatatccagcatgatcacaggtgtt
gctgcactggattccaacgtgtccggaaaaattggtctgcgtgctgtcgtatattattta
tgcacaactatcattgctgtgatcctaggaatcgtgctggtggtgagcatcaagcctggt
gtcagccagaaagtggatgaaattgacagggtaggcagcacccctgatgtcagcacagtg
gactccatgctcgacctgatcagaaatatgttccctgagaacctcgtccaagcctgtttc
cagcagtacaaaaccagacgtgaggaagtgaatcctgcaggtgagccagagatgaacatg
acggaagactccgtcacagctgccatgacgaccacagtttccaagaacaagacaaaggaa
tacacggttgtgggcctctattccgatggcatgaatgtcctgggcttgattgtcttttgc
ctcgtctttgggattgtcattggaaaaatgggagaaagggggcagattctggtggatttc
ttcaatgccttgaacgatgcaaccatgcagattgtgcagaccatcatgtgttacatgccg
cttgggattctgttcctgatcgccgggaagatcatagaagttgaagactgggaagtattc
cgcaagctgggcctgtacatggccacagtgctgagtgggcttgcgatccactccatcata
atcctcccgctgatatacttcatagtcgtacgaaagaacccgttccgatttgccatggga
atggcacaggctctcttgacagctctcatgatctcttccagctcggcaacactgcctatc
accttgtgctgtgcggaggaaaagaatctggtggacaggagaatcacaagatttgtgctg
cccgttggcgctacgatcaacatggatggaggcgcgctctacgaggcagtagccactgtg
ttcattgcacagttgaataacttggacttgggcattgggcagatcgtcactatctgtgtc
gcagccacagccagcagcataggagccgctggcgtgccccaggccggtctggtgaccatg
gtgatcgtgctgagtgccgtgggcctgcccgctgaggatgtcaccctcatcatcgctgtt
gactggctcctggaccggttccgaaccgtggtgaacgtgctcggagatgcatttgggaca
ggcatcgtggagaagctctccaagaaggagctggagcagatggatgcttcatccgaagtc
aacatagtgaacccctttgccttggaatccaccatacttgataatgaagacccagagacc
aagaagtcctatgtcaatggaggcttcgcagtagataagtctgatgccatctcgttcacc
cagacctcacagttctag

KEGG   Loxodonta africana (African savanna elephant): 100673388
Entry
100673388         CDS       T04351                                 

Gene name
SLC1A6
Definition
(RefSeq) excitatory amino acid transporter 4 isoform X1
  KO
K05617  solute carrier family 1 (high affinity glutamate/aspartate transporter), member 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04724  Glutamatergic synapse
lav05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100673388 (SLC1A6)
   04721 Synaptic vesicle cycle
    100673388 (SLC1A6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100673388 (SLC1A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100673388 (SLC1A6)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   100673388 (SLC1A6)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 100673388
NCBI-ProteinID: XP_003413096
UniProt: G3T795
LinkDB
Position
Unknown
AA seq 562 aa
MSSHANSLFLRESGQRLGRVGCLQQLQESLQQRALRTRLRLQTMTREHVLRFLCRNAFIL
LTISAVVIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLD
NKATGRMGMRAAVYYMVTTVIAVFIGILMVTIIHPGKGSKEGLHREGRVEPVPTADAFMD
LVRNMFPPNLVEACFKQFKTQYSTRVVTRTIVRTENGSELGTSMPPTSSVDNGTSLLENV
TRALGTLHEVLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLN
EAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLLLHAGGVLPL
IYFLITHRNPFPFIGGLLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA
TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVL
TSVGLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLG
KPYKSLQEKGMSRGRGGNESAM
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgagcagccacgccaacagcctgtttctgcgggagagcggccagcggctgggccgggtg
ggctgcctgcagcagctgcaggagagcttgcaacagagagcacttcgcacgcgcctgcgc
ctgcagaccatgacccgtgagcacgtgctgcgcttcctgtgccgcaatgccttcatcctg
ctgaccatcagcgctgtggtcattggagtcagcctggcctttgctctgcgcccataccaa
ctcacctaccgccagatcaagtatttctcgttccctggagagctgctcatgaggatgctg
cagatgttggtgctgcccctcattgtctccagcctggtcacaggcatggcgtctctggac
aacaaggcaaccgggcgaatggggatgagggcagctgtgtactacatggtgaccacagtc
atcgctgtcttcattggcatcctcatggtcaccatcatccatcctgggaagggctccaag
gaggggctgcaccgcgagggccgggttgagcccgtccccacagctgatgccttcatggac
ctggtcagaaatatgtttccgcccaaccttgtggaagcctgcttcaaacagttcaagacg
cagtatagcacaagggtggtaaccaggaccattgtgaggacagagaacgggtctgagctg
ggcacctccatgcctcctacgtcctcagtggacaatgggacaagtctcctggaaaatgtc
acacgggccctgggcaccctgcacgaggtgctgagcttcgaggagactgtaccagtgcct
ggctcagccaatggcatcaatgcgctgggcctcgtggtcttctctgtggcctttgggctg
gtcatcggtggcatgaagcataagggccgagtcctgcgggacttcttcgacagcctcaat
gaggctattatgcggctggtgggcatcattatctggtacgcacctgtgggcatcctcttc
ctgattgctgggaagatcctggagatggaagacatggccgtcctggggggtcagctgggc
atgtacaccctgacagtcatcgttggcttgttactccatgctggcggtgtcctccccctc
atctacttcctcatcacccaccggaaccccttccccttcatcggtggcttgctgcaggcc
ctcatcaccgctatgggcacgtcttccagctccgcaacactgcctatcaccttccgctgc
ctggaggagggcctgggtgtggaccgccgcatcaccaggtttgtgctgcctgtgggggct
actgtgaacatggatggcaccgccctctacgaggccctggccgccatcttcattgcccag
gtcaacaactatgagctcaatctgggccagatcacaaccatcagcatcacggccacagca
gccagtgttggggctgctggcatcccccaggctggtctggtcaccatggtgattgtgctc
acatcggttggcctgcccactgaagacatcactcttattatagctgtggactggttcctt
gaccggcttcgcaccatgaccaacgttctaggggactcgattggagcggctgttattgag
cacttatctcagcgggagctggagctgcaggaagcagagctcacccttcccagcttgggg
aagccctacaagtctctacaggagaaggggatgtccagggggcggggaggcaacgagagt
gccatgtga

DBGET integrated database retrieval system