KEGG   Loxodonta africana (African savanna elephant): 100671543
Entry
100671543         CDS       T04351                                 

Gene name
TRPM4
Definition
(RefSeq) LOW QUALITY PROTEIN: transient receptor potential cation channel subfamily M member 4
  KO
K04979  transient receptor potential cation channel subfamily M member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100671543 (TRPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100671543 (TRPM4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100671543 (TRPM4)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Other DBs
NCBI-GeneID: 100671543
NCBI-ProteinID: XP_023399830
LinkDB
Position
Unknown
AA seq 1082 aa
MVVPEKEQSWIPKIFKKKTCTTFIVDLTDPGGTLCQCGRPRSAHLSVAVEDAFGAAVVTV
WDSDVHTTEKPTDAYGDLDFLGSGRKASNFLRLSDRTDPAAAYNLVTNTWGIPPPNLVVS
VLGGSGAPILQTWLQDLLRRGLVRAAQSTGAWIVTSGLHRGIGQHVGVAVRDHQTASIGG
SKVVAMGVAPWGVVRNRDALLNSKGSFPARYPWRSSPEDRDQEDRRQFPLDYNYSAFFLV
DDGTHGRLGGENHFRLSFESYISRQKTGVGGTGIDIPVLLLLIDGDEKRLEQIENATQAQ
LPCLLVAGSGGVADCLAETLEDTLTLGSGVCRRGEAQDRIKRFFPKGDPEVLQAQVERIM
TRKELLTVYSLEDGPEDFETIVLKALVKGKTWTSIFFSSLSLALDTFPGLGVLSILSNLS
FMLLFISLFIPFTSAVFFRALHGPCLSHPSPNAVASALGACLLLRALARMESEAEEAERR
KDLAAKFEGLGVGLFGQCYRSDEKWAAWLLLRRCPLWGNATCLQLAMQADARAFFAQDGV
QSLLTQKWXETMTPLRLSGPGSHFFCPPLIYTDLITSGQKSREEFAPKDLEFDMDKGMNG
EGPFGLADPIEKMPLGVSKQPRHSRCPRGPCWGQCLHRWAHFWGAPGTAFMGNVVSYLLF
LLLFARVLLIDFHPETISTLEVLLYFWAFTLLCEEVRQSLGREWGSLAIGPQGWRHTPTG
AGGWTLYLGGHLEPGGTLLGPHCFLLGMGCRMTPGLYELGRTVFCLDFMVFTVRLLHIFT
VNKQLGPKIVIVNKMMKDVFFFLFFLGVWLVAYGVATEGLLRPQDRNLPNILRRVFYRPY
LQIFGQIPQEEMDVALMDHVNCSLEQGFWANASGTRMGSCVSIYANWLVLLLLVVFLLVA
NILLVNLLIAMFSHTFGKVQGNSDLYWKAQRYSLIREFHTRPALAPPFIIISHVRLLIRL
LRSLWTRLPFTRDAKHFRVCLPKDDERRLLTWESVQKENFLLARARDKRESDSERLKRTS
QKVDSALKQLGQIRQYEQRLKGLKREVRHCSRVLDWMAETLSHSPLLPPGGPPPPAPPGL
KD
NT seq 3249 nt   +upstreamnt  +downstreamnt
atggtggttcccgagaaggagcagagctggatccccaagatcttcaagaagaaaacctgc
accactttcatcgttgacctcacagatccaggagggaccctctgccagtgtgggcgcccc
cggagtgcacacctgtcagtggctgtagaggacgcattcggggcggctgtggtgaccgtg
tgggatagtgatgtgcacaccaccgagaagcccaccgacgcctacggggacctggatttc
ctgggctcgggccgcaaggccagcaatttcctccgtctctctgaccgcacggatccagca
gcagcctataatctggtcacaaacacatgggggatcccccctccgaacctggtcgtgtca
gtgctgggaggctcaggggcccccatcctccagacctggctgcaggacctgcttcgtcgt
gggctggtgcgggctgcccagagcacaggggcctggattgtcaccagtgggctgcacagg
ggcattggccagcacgttggtgtggcggtgcgggaccaccagacagccagcattgggggc
agcaaggtggtagccatgggcgtggccccctggggtgtggtccggaacagagatgccctc
ctcaactccaagggctccttccctgcgaggtatccatggcgcagcagccccgaggacagg
gaccaggaggataggcgccagtttcccctcgactacaattactctgccttcttccttgtt
gacgatggcacacatggccgcctgggcggcgagaaccacttccgcttgagttttgaatcc
tacatctctcggcagaagacgggcgttggagggactggaattgacatccctgttctcctc
ctcctgattgatggtgatgagaagaggttggagcaaatagagaacgccacccaggcccag
cttccctgtctcctggtggctgggtctgggggtgttgcagactgcctggcagagaccctg
gaggacactttgaccctagggagtggggtgtgcaggcggggcgaagctcaagatcggatt
aagcgtttctttcccaaaggagaccctgaggttctgcaggctcaggtggagaggatcatg
acccgaaaagagctgctgacagtttattctcttgaggatggccctgaggattttgagacc
atcgttttgaaggcccttgtgaagggtaagacttggacctccatattcttctcctctctc
agtttagccttggatacgtttcctggcctgggcgttttatccattctctctaacctaagc
ttcatgcttctttttatctctctctttatacccttcacttctgcagtgtttttcagggct
ttgcatggtccttgtcttagtcatccaagccccaatgctgtggcctcagctcttggggcc
tgtttactgctccgagcgctggcacgcatggaatcggaggctgaggaggcagaacggagg
aaggacctggcggccaagtttgaggggctgggtgttggcctctttggccagtgctaccgc
agtgatgagaaatgggctgcctggctactccttcgccgctgcccactctgggggaatgcc
acctgcctccagcttgccatgcaggctgacgcccgtgccttctttgcccaggatggggta
cagtctctgctgacacagaaatggtgagagacgatgacaccactacgcctgtctggccct
ggttctcacttcttttgccccccactcatctacactgacctcatcacttcaggtcagaag
tccagagaggagtttgcaccgaaggacctggagtttgacatggataagggcatgaatggg
gaagggcctttcgggctggccgaccccatagagaagatgccattgggagtgtcaaagcag
cccagacacagcagatgccctagggggccctgctggggtcagtgcctgcaccggtgggcc
cacttctggggggccccggggacggccttcatgggcaacgtggtaagctacctgctcttc
ctgctgctctttgcccgggtgctgctcatcgacttccatcctgagacaatcagcaccctc
gaggtgctgctgtacttctgggccttcaccctcctctgcgaggaggtccggcagagcctg
ggcagggagtggggcagcctggccatcgggccgcaggggtggaggcacacccccactggg
gccggggggtggaccctctacctcggtggacacctggaaccaggggggactttattgggc
cctcactgcttcctcctgggcatgggctgccggatgacccccggcctctatgaacttggc
cgcaccgtcttctgcctcgacttcatggtcttcacggtgcggctgctgcacattttcaca
gtcaacaaacagctggggcccaagatcgtcatcgtgaacaagatgatgaaggatgtgttc
ttcttcctcttcttccttggcgtgtggctggttgcctatggggtggccacggaggggctc
ctaaggccccaggaccgcaacctaccaaatatcctgcgccgcgtcttctaccggccttac
ctacagatttttgggcagatcccccaggaagagatggatgtggccctcatggaccatgtc
aactgttcgttggagcagggcttctgggcgaacgcttcggggacacgcatgggctcctgt
gtctctatttatgccaactggctggtactactgctcctagtcgtcttcctgctcgtggcc
aacatactgctggtcaatctgctcattgctatgttcagccacacgttcggcaaagtacag
gggaacagtgacctctactggaaggcccagcgctacagcctcatccgagaattccacact
cggcccgcgctggccccgcccttcatcatcatttcgcacgtgcgccttctcatccggcta
ctgcgcagcctctggactaggttgccgttcacccgggacgccaagcatttccgggtctgc
cttccgaaagacgacgagcggaggctgttgacatgggagtcggtgcagaaagagaatttc
ctgctggcgcgcgcgcgggacaaaagggagagcgactctgagcgtctgaagcgcacgtcg
cagaaggtggacagtgcgttgaagcagctgggacagatccgtcagtacgagcagcgtttg
aaaggcctgaagcgggaggtccggcactgcagtcgcgtactggactggatggctgagacc
ctgagccactctccgttgctgccccccgggggaccaccgcccccagccccacctggactc
aaagactga

DBGET integrated database retrieval system