KEGG   Loxodonta africana (African savanna elephant): 100671600Help
Entry
100671600         CDS       T04351                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100671600 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100671600 (KMT5B)
Enzymes [BR:lav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100671600 (KMT5B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100671600 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100671600
NCBI-ProteinID: XP_003419589
UniProt: G3SYA6
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSDDHPQTPSRFPHAGKDTLKAGRSAVDRRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HSNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRAGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKNRTLTRQSMSRIPA
SSNSTSSKLTHMNNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKTASRKLEMGNLVLKEP
KVVLYKNLPIKKDKELEGPVQAGVASGCLTRHAAREHRQNSVRGAHTRGEGSPCSYITRR
SVRTRMSLKEASEVRLDPDAADGLRDSPVEPCADEDEQPVPGLQEENLTRETTQKGDSQC
HKSDTTMSKKKSRQGKLVKQFTKMEESAPGRDSPGRDSSGPDVPGSHSDQGEHSGTGGAP
VGYTDCAPSPVGCSIVTSDSFKTKDGFRTARSRKKRRITRYDAQLILENNSGIPKLTLRR
RHDSSSKTNDQENDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGGSSTKLKIQLK
RDEEGRGSYAEGLHENGVCCSDPLSLLESRMEVDDYGQYEEESTDDPSSSEGDEEEDDYD
DDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctgatgaccatccgcagactccatccagattcccgcatgcgggaaaggacaccctg
aaggctggcagaagtgcagttgacaggaggtcgagcagatgtaatggtaattctggattc
gaaggacagagtcgctatgtaccatcttctggaatgtctgccaaggaactttgtgaaaat
gatgacctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatcggacagttttcct
catagcaaccccgtgaggtttcggcctattaaaggaaggcaagaagaactgaaggaagtg
atagagcgttttaagaaagatgagcacttggagaaagccttcaaatgtttgacttcaggc
gaatgggcgcggcactattttcttaacaagaacaaaatgcaggagaaattattcaaagaa
catgtatttatttacttgcgaatgtttgcaactgacagtggatttgagatattgccttgt
aatagatactcatcagagcaaaatggagccaaaatagtggcaacgaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagagaacgacttcagtgtcatgtactccacgaggaagaactgt
gcccagctctggctcgggcctgctgcgttcataaaccacgattgcagacctaactgcaag
tttgtgtcaactggccgagacacagcatgtgtgaaggctttaagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgaattctgcgag
tgttacacgtgtgaaagacggggcactggtgcttttaaatccagagcgggactccctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcagtctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaagtcttcagttggt
gtgaaaaagaacagcaaaaacagaacgttaaccaggcaatctatgtccagaattccagct
tcttccaactctacctcatctaaactaactcacatgaataattccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttactttcaaagataaaattaagaaatcattgcaaacgg
ctggagcaaaagactgcttcccgaaaacttgaaatgggaaacttagtacttaaagagcct
aaagtagttctgtataaaaatctgcccattaaaaaagacaaggagctggagggaccagta
caagctggagtggccagtgggtgcttgactagacacgcagcgagagaacacagacagaat
tctgtgagaggtgctcacacgcggggcgagggctccccctgttcttacatcacccggcgg
tcggtgcggacgcggatgagcctgaaggaggcctctgaggtcaggctggacccagacgca
gcggacggcctcagagacagcccggtggagccatgcgcagacgaggacgagcagccagtc
cctgggctgcaggaggagaacctgactcgtgaaaccacacagaagggggactcacagtgt
cacaagagtgacaccaccatgtcaaaaaagaaatcacgacaaggaaagcttgtgaagcag
ttcaccaaaatggaggagtctgctccggggcgtgattcccctgggagagacagctcgggg
ccagatgtgccaggctcccattctgaccagggggagcacagtggcacggggggtgcgcct
gtgggctacacggactgcgccccctcgcccgttggttgttcaattgttacgtcagacagc
ttcaaaacaaaagacggctttaggactgcaagaagcaggaagaagaggcggatcacgcgg
tatgatgcacagctcatcctggaaaacaactccgggattcccaaattgactctacgcagg
cgtcacgacagcagcagcaagacaaacgaccaagagaatgatgggatgaattcctcaaaa
ataagcatcaagttaagtaaagaccatgaaaatgataataatctctatgtagcaaagctg
aataatggatttaactcagggtcaggcggtagttctacgaaattaaaaatccagctgaaa
cgggacgaggagggtagggggtcgtacgcagagggccttcacgagaacggggtgtgctgt
agcgaccccctctccctcctggagtcccggatggaggttgacgactacggtcagtacgaa
gaggaaagtactgatgacccctcctcctcggagggcgacgaggaggaggatgactatgat
gatgactttgaagatgactttattcctcttcccccagctaagcggttgaggctgatcgtc
gggaaggactccatcgatattgacatttcttcccggaggagagaagaccagtctctgagg
ctcaatgcgtaa

DBGET integrated database retrieval system