KEGG   Loxodonta africana (African savanna elephant): 100671706
Entry
100671706         CDS       T04351                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04630  JAK-STAT signaling pathway
lav04921  Oxytocin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100671706 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100671706 (CDKN1A)
   04066 HIF-1 signaling pathway
    100671706 (CDKN1A)
   04068 FoxO signaling pathway
    100671706 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100671706 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100671706 (CDKN1A)
   04115 p53 signaling pathway
    100671706 (CDKN1A)
   04218 Cellular senescence
    100671706 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100671706 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100671706 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671706 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100671706 (CDKN1A)
   05206 MicroRNAs in cancer
    100671706 (CDKN1A)
   05205 Proteoglycans in cancer
    100671706 (CDKN1A)
   05203 Viral carcinogenesis
    100671706 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100671706 (CDKN1A)
   05212 Pancreatic cancer
    100671706 (CDKN1A)
   05225 Hepatocellular carcinoma
    100671706 (CDKN1A)
   05226 Gastric cancer
    100671706 (CDKN1A)
   05214 Glioma
    100671706 (CDKN1A)
   05216 Thyroid cancer
    100671706 (CDKN1A)
   05220 Chronic myeloid leukemia
    100671706 (CDKN1A)
   05217 Basal cell carcinoma
    100671706 (CDKN1A)
   05218 Melanoma
    100671706 (CDKN1A)
   05211 Renal cell carcinoma
    100671706 (CDKN1A)
   05219 Bladder cancer
    100671706 (CDKN1A)
   05215 Prostate cancer
    100671706 (CDKN1A)
   05213 Endometrial cancer
    100671706 (CDKN1A)
   05224 Breast cancer
    100671706 (CDKN1A)
   05222 Small cell lung cancer
    100671706 (CDKN1A)
   05223 Non-small cell lung cancer
    100671706 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100671706 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100671706 (CDKN1A)
   05161 Hepatitis B
    100671706 (CDKN1A)
   05160 Hepatitis C
    100671706 (CDKN1A)
   05163 Human cytomegalovirus infection
    100671706 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100671706 (CDKN1A)
   05169 Epstein-Barr virus infection
    100671706 (CDKN1A)
   05165 Human papillomavirus infection
    100671706 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100671706 (CDKN1A)
   01522 Endocrine resistance
    100671706 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100671706
NCBI-ProteinID: XP_003403988
UniProt: G3U4L3
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSGDTAQIPCSSKVCRRLFGPVDEEQLRRDCDALMADCLQEARARWNFDFVTETPLE
GNYVWERVQGLGLPKFYLPAGPRGAWDDLGGGKRPCTSTVLLQGTAQGDHVDLSLSCTVV
PRSPERPEVSPGGPGARQGRKRGQTSMTDFYHSKRRLVFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccgtcaggggacaccgcccagatcccctgcagcagcaaggtgtgtcgccgc
ctctttggccctgtggacgaagagcagctgcgccgcgactgtgatgcgctaatggcagac
tgtttgcaagaggcacgtgcacgttggaacttcgactttgtcaccgagacacctctggag
ggcaactatgtctgggagcgtgtgcagggccttggcctgccgaagttctatctgcctgca
gggcctcggggggcctgggatgacctgggagggggcaagcggccctgcacctcaactgtt
ttgcttcaggggacggcccaaggggaccacgtggacctgtcgctgtcctgtaccgtcgtg
cctcgttcccctgagcggcctgaagtgtctccaggtgggcctggtgcacgtcagggccgg
aagcggggacagaccagcatgacagatttctaccactccaaacgtcggctggtgttctcc
aagaggaagccgtaa

DBGET integrated database retrieval system