KEGG   Loxodonta africana (African savanna elephant): 100671811
Entry
100671811         CDS       T04351                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04371  Apelin signaling pathway
lav04912  GnRH signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05020  Prion disease
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100671811 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100671811 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100671811 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100671811 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100671811 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100671811 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100671811 (EGR1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100671811 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Cornifin Zf_RING zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 100671811
NCBI-ProteinID: XP_003404571
UniProt: G3U525
LinkDB
Position
Unknown
AA seq 548 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGG
NSSSSGGGGGGGSGSNSSSSAFNPQGEAGEQPYEHLTAEPFPDISLNNEKVLVETSYPSQ
TTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMSNPPATSTSAPSPAASSSSS
ASQSPPLSCAVQSNDSSPIYSAAPTFPTPNTDIFPEPQSQSFSGSAGTALQYPPPAYPAA
KGGFQVPMIPDYLFPQQQGDLGLGTPEQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQD
LKALNNTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHT
GQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKD
KKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPVTTSYPSPATTSYPSPVPTSYS
SPGSSTYPSPVHSGFSSPSVATTYSSVPPAFPAQVSSFPSSAVANSFSASTGLSDMTATF
SPRTIEIC
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggccgcggccaaagccgagatgcagctgatgtccccgctgcagatctccgacccgttc
ggctcctttcctcactcgcccaccatggacaactaccccaagctggaagagatgatgctg
ctgagcaacggggcgccccagttcctcggtgccgccggagcccctgagggcagcggcggt
aacagcagcagcagcgggggcggtggaggtggagggagcggcagcaacagcagcagcagc
gccttcaaccctcagggggaggcaggcgagcaaccctacgagcacctcaccgcagagcct
tttcctgacatctctctgaataatgagaaggtgctggtggagacgagctaccccagccaa
accacccggctgccccccatcacctacactggccgcttctctcttgagcctgcgcccaac
agtggcaacaccctgtggcccgagcccctcttcagcctggtcagtggcctcgtgagcatg
agcaacccaccagccacctcaacctctgcgccctctccagcggcctcctcctcttcctct
gcctcccagagcccacccctgagctgcgcagtacagtccaacgacagcagccccatttac
tctgcagcgcccaccttccccacacccaacactgacattttcccagagccacaaagccag
tccttttctggttcggctggcactgcgcttcagtacccgcctcctgcctaccctgctgcc
aagggcggtttccaggttccaatgatccccgactacctgtttccacagcagcagggggac
ctgggcctaggcaccccagaacagaagcccttccagggactggagagccgcactcagcag
ccttcgctcactccgctctccaccatcaaggcctttgccacacagtcgggctcccaagac
ttgaaggccctcaataacacttatcagtcccagcttatcaaacccagccgcatgcgcaag
taccccaaccggcccagcaagactcctccccacgaacgtccctacgcctgcccggtggag
tcctgcgatcgccgcttctcccgttctgacgagcttactcgccacatccgcatccacacg
ggccagaagcccttccagtgtcgcatctgcatgcgcaacttcagccgcagtgaccacctt
accacccacatccgcacccacacaggcgagaagccctttgcctgcgacatttgtgggaga
aagtttgccagaagcgatgaacgcaaaaggcataccaagatccacttgcggcagaaggac
aagaaagcagataaaagtgttgtggcctcttcggccacctcctccctctcttcctaccca
tccccagttgctacctcttacccatccccagtcactacctcttacccgtccccagtcact
acctcttacccgtccccagccaccacctcatacccatcgccggtgcccacctcttactcc
tctcccggctcttcgacctacccgtcccctgtccacagtggcttctcctcaccttcagtg
gccaccacatactcctcggttccccctgctttcccggcccaagtcagcagcttcccttcc
tcagcagttgccaactccttcagcgcctccacagggctttcggacatgacggccacattt
tctcccaggacaattgaaatttgctga

DBGET integrated database retrieval system