KEGG   Loxodonta africana (African savanna elephant): 100671889
Entry
100671889         CDS       T04351                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7 isoform X1
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04540  Gap junction
lav04657  IL-17 signaling pathway
lav04722  Neurotrophin signaling pathway
lav04912  GnRH signaling pathway
lav04921  Oxytocin signaling pathway
lav05206  MicroRNAs in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100671889 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100671889 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100671889 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100671889 (MAPK7)
   04921 Oxytocin signaling pathway
    100671889 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100671889 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100671889 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100671889 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671889 (MAPK7)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100671889 (MAPK7)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100671889 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 100671889
NCBI-ProteinID: XP_003420719
UniProt: G3T5A7
LinkDB
Position
Unknown
AA seq 801 aa
MAEPLKEEDGEDGSGEPPGQVKAEPANPTASVAAKNLALLKARSFDVTFDVGEEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPMVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPGARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLHPVASEPGCPDIEMP
SPWAPGGDCAMESPPPAPPPCPGPAPDTIDLTAQPPLPASELAPPKREGAISDNTKAALK
AALLKSLRNRLKDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGATGAPSSDPLAGLVLSDNDRSLLERWTRMAQPSAPAPPPAQPASPPPGPVAQQT
GPPPQPVGSTPGPSAQPVCPPPEPATHPAGPPGPIPVPAPLQSNMSSLLAPQPLVSPPGL
PGPSALGVLPYFPSGPPPADPGGAPHLSTSESPDVNLVTQQLSKSQVEDPLPPVFSGTPK
GSGAGYGVGFDLEEFLNQSFDMGMADGPQDGQADSASLSASLLADWLEGHGMNPADIESL
QREIQMDSPMLLADLPDLQEP
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggccgagcccctgaaggaggaagacggcgaggacggctccggggagcctccggggcaa
gtgaaggcagagcccgccaatcccacagcctcggtggcggctaagaacctagctctgctc
aaagcccgctccttcgatgtgacctttgacgtgggcgaggagtacgaaatcatcgagacc
ataggcaatggggcctacggggtggtgtcctctgctcgccgccgcctcacgggccagcag
gtggccatcaagaagatccctaatgcttttgatgtggtgaccaatgccaagcgaacgctg
agggagctgaagatccttaaacactttaagcatgacaacatcatcgccatcaaggacatc
ctgaggcccatggtgccctatggcgagttcaaatctgtctatgtggtcttggacctgatg
gagagtgacctgcaccagatcatccactcttcacagccactaacgctggagcatgtgcgc
tacttcctgtaccagctgcttcgaggcctcaagtatatgcactcggctcaggtcatccac
cgtgacctcaagccctcaaatttgttagtgaatgagaactgtgagctcaagattggggac
tttggcatggcccgtggcctgtgcacctcgcccgccgaacaccagtacttcatgactgag
tatgtggccacgcgctggtaccgggcccctgagctcatgctttcactgcatgagtacaca
caggctattgacttgtggtctgtgggctgcatctttggggagatgctggcccggcgccag
ctttttccaggcaaaaactatgtgcaccagctgcagctgatcatgatggtgctgggtacc
ccgtcaccagctgtgattcaagctgtgggggctgagagggtgcgggcttatattcagagc
ctgccaccgcgccagcccgtgccctgggagacggtgtacccaggcgctgaccgacaggcg
ctctcgctgctgggccgcatgctacgtttcgagcctggcgcccgcatctcagcagctgct
gccctgcgccaccccttcctggccaagtaccatgaccctgatgatgagcctgactgtgct
ccaccttttgactttgcctttgaccgtgaagccctcacccgggagcgtattaaggaggca
atcgtggctgagattgaggacttccatgcccgacgtgagggcatccgccagcagatccgc
ttccagccttccctacaccctgtggccagtgagcctggctgtcccgacattgagatgccc
agtccctgggcacctggtggggactgtgccatggagtcgcccccgccagccccaccaccg
tgccccggccctgcacctgacaccattgatctgactgcccagccacctctgcctgccagc
gagctggcccctccaaagagagaaggtgccatctcagacaacaccaaggcggccctcaaa
gccgctctcctgaagtccttacggaaccggctcaaagatggccccagtgctcctctggag
gcccctgagcctcgaaagccagtgacggcccaggaacgtcagcgagagcgggaggagaag
cggcggcggcggcaggaacgggccaaggagcgggagaagcggcggcaggagagggagcga
aaggagcgaggagctggggccactggggccccctccagtgaccctctggccgggctggtg
ctcagtgacaatgaccgcagcctgctggagcgttggactcgcatggctcagccctcagca
ccagcgccacccccagcccagcccgccagtcctccccctggccctgtagcccagcaaact
ggtcccccacctcaacctgtaggctcaacccctggtccttcagcccagcctgtctgccca
ccccctgagcctgctactcaccccgctggccctcctgggcccatccctgtccctgctcct
ctccagtccaacatgtccagcctcttggccccccaaccgcttgtgtcaccccctgggctg
cctggccccagtgccctgggagtcctgccttacttcccatctggcccaccccctgcagac
cctgggggagcccctcacctctccacctcagagtcacctgacgttaacctggtgacccag
cagctgtccaagtcgcaggtggaggaccccctgccccctgtgttctcaggcactccaaag
ggcagcggggctgggtatggtgtcggctttgacctggaggagttcttgaaccaatctttt
gacatgggcatggctgacgggccacaggatggccaggcggactcggcctccttgtcagcc
tccctgcttgctgactggttggagggtcatggcatgaaccctgctgacattgagtcactg
cagcgtgagatccagatggactccccgatgctgctggctgacctgcctgaccttcaggag
ccctga

DBGET integrated database retrieval system