KEGG   Loxodonta africana (African savanna elephant): 100671890
Entry
100671890         CDS       T04351                                 

Gene name
FFAR1
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100671890 (FFAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100671890 (FFAR1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    100671890 (FFAR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100671890
NCBI-ProteinID: XP_003420851
UniProt: G3UA16
LinkDB
Position
Unknown
AA seq 300 aa
MDLPPQLFFALYVTAFALGFPLNVLVIRSAASHARLRLTPSLVYALHLGCSDLLLAVSLP
LKAVEALAEGAWLLPAALCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPLGYQAIRRP
CYSWGVCAAIWALVLCHLGLVLGLEAPGGWMDNATSSLGISTPVNGSPVCLEAWDPTLAG
PARFSLSLLFFFLPLTITAFCYVGCVRALAHSGLSHRRKLRAAWVAGGALLTLLLCLGPY
NASNVAGFLRPDMGGGWRKLGLITGAWSVVLNPLVTGYLGGGTGQWVACVAKMQEMTSQK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggacctgcctccgcagctcttctttgccctctatgtgactgcctttgcactgggcttc
ccgctcaacgtgctggtcatccgaagtgccgcgtcccatgcccggctccgcctcactccc
agccttgtctatgccctccacctgggctgctctgacctcttgctggcagtctctctgccc
ctgaaggcagtggaggccctggctgagggggcctggcttctgccagctgccctctgccct
gtctttgccctggcccacttcgctcccctctatgcaggtgggggcttcctggctgccctg
agtgctggccgctacctgggggcagccttccccttgggctaccaagccatccggaggcca
tgctactcctggggtgtgtgtgcggctatatgggcccttgtcctctgtcacctgggtctg
gtcttggggttggaggctccaggaggctggatggacaatgccaccagttccctgggcatc
agcacaccagtcaatggctctccagtctgcctggaggcctgggacccaactttagctggc
cctgctcgcttcagtctctccctcttgttcttcttcctgcccttgaccatcacagccttc
tgctatgtgggctgtgtccgggcactggcccactcaggtctgagccacagacggaagctg
agggcagcctgggtggctgggggggctctgctcactctgcttctctgcctcgggccctac
aatgcctccaatgtggctggcttcctgcgccccgacatgggaggtggctggcggaagctg
gggcttatcacaggtgcctggagtgtcgtactcaacccactggtgactggttacttggga
ggggggactggccagtgggtagcatgtgtggcaaaaatgcaagagatgacatctcagaag
tag

DBGET integrated database retrieval system