KEGG   Loxodonta africana (African savanna elephant): 100672028Help
Entry
100672028         CDS       T04351                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4 isoform X1
  KO
K09289  nuclear receptor coactivator 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04216  Ferroptosis
lav05200  Pathways in cancer
lav05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100672028 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672028 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100672028 (NCOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARA70
Motif
Other DBs
NCBI-GeneID: 100672028
NCBI-ProteinID: XP_010587582
LinkDB All DBs
Position
Unknown
AA seq 626 aa AA seqDB search
MSTSQDQSGCSSNREPLLRCCEARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFSCLIHQLECSQNKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTTALRQTITTFGTLKTMQIPEHLMAHANSSSTGPFLE
KRGYIPVPEQQKSSSGTTAVPLSEWLLGSKPASGHRALYVPSTNPQDWLTQKQTLENSQT
SPRAGSFFSNVWGNLKGLENWLLKSQQQEVPEKPSYQKFNSCSSTSSSSVDVKKVRDLEL
LDQDEVDLSNWLLTPQKPQKLEKPENGSCETNEKFKLLFQVFQESYNVSDWLVKPSSCTN
CQGNQPKGVEIENLSNLKCLNDHLEAKKPPSPPSMVTMDWLVQNHQEPYKVEEVCRANEP
CTSFSECVCDENCEKEALCTWLLKKEGKDKNGMPVDPKPELEKLRESLTMWLCPSRKEAA
GEAKTPKATAPSRVADTFQVIRNSPLSEWLIRPPRKEGSPREVPSTEDKAGKQKLVSPTA
TSWCPFNTADWVLPGKNTGKLSQASSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDCYGLP
AVCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttcacaggaccagagtggctgctccagtaatcgagagccccttttgaggtgt
tgcgaagcacgaagggacttagagcttgctattgggggagttctccgggctgaacagcaa
attaaagataaccttcgagaggtcaaagctcagattcacagctgcataagccgtcacctg
gaatgccttcgaagccgtgaggtgtggctgtatgaacaagtcgacctcatctatcagctg
aaagaggagaccctgcagcagcaagcccagcagctctactggttattgggccagttcagt
tgtctcattcatcagctggagtgctcccaaaacaaagatctagccaatcaagtttctgtg
tgcctggagagactgggcagtttgactcttaaaccagaagattcaactgtcctgctcttt
gaagcagacacaactgcactgcgtcagaccatcaccacatttgggaccctcaagaccatg
caaattcctgagcacctgatggctcatgctaattcatcaagtactggacccttcttggag
aagaggggttatatcccagtgccagagcagcagaagtcatcatccggcaccacagccgtc
cctctcagtgaatggctccttggaagcaaacctgccagtggtcatcgggctctgtatgta
cccagcaccaacccccaggactggctcacccaaaagcagaccttagagaatagtcagact
tctcccagagccggcagtttcttcagtaatgtctggggtaacctcaagggcttggaaaac
tggcttctcaagagtcagcaacaagaagttcctgaaaaaccaagttaccaaaagtttaac
agctgttcttctaccagttcttcctccgttgatgttaaaaaggtcagagatctggagctt
cttgatcaagatgaggtggacctttccaactggctgctgactccccagaaaccccaaaag
ctggagaagccagagaatggcagttgtgaaaccaatgagaagtttaagctcttgttccag
gttttccaggagtcctataatgtgagcgattggcttgtcaagcccagttcctgtaccaat
tgtcagggcaaccagcccaaaggtgtagagattgaaaacctaagcaatctgaagtgcctg
aatgaccacctggaggctaagaaaccaccatccccccccagcatggttaccatggattgg
cttgtccagaaccatcaagaaccctataaagtagaagaggtatgcagagccaacgagccc
tgcacaagcttttcagagtgtgtgtgtgatgaaaattgtgagaaggaagctctgtgtaca
tggcttctgaagaaagaaggaaaagataaaaacgggatgcctgtggatccaaaacctgag
ctcgagaagcttagagagtcactgactatgtggctctgtccttccagaaaagaggcggca
ggagaagctaagacaccaaaggccacagctccttccagagttgctgatacctttcaagtc
ataaggaacagccccttgtccgagtggctcataagaccacctcgcaaagaaggaagtccc
agggaggtgcctagtaccgaggacaaagctggcaaacaaaagcttgtgagtcccacggcc
acttcctggtgtcccttcaacacagctgactgggtcttgccaggaaagaacacaggaaag
ctcagccaggcatcctctggagaagacaagtggttactgcgaaaaaaggcccaggaagtc
ttacttaattcacccctacaggaggaacataactttccgccagactgttacggcctccca
gcagtttgtgatctctttgcctgtatgcagcttaaagttgataaggaaaagtggttgtat
cgaactcctctacagatgtga

DBGET integrated database retrieval system