KEGG   Loxodonta africana (African savanna elephant): 100672072
Entry
100672072         CDS       T04351                                 

Gene name
NPPC
Definition
(RefSeq) C-type natriuretic peptide isoform X2
  KO
K12336  natriuretic peptide C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100672072 (NPPC)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672072 (NPPC)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100672072 (NPPC)
SSDB
Motif
Pfam: ANP DUF1180
Other DBs
NCBI-GeneID: 100672072
NCBI-ProteinID: XP_003417960
UniProt: G3TJJ0
LinkDB
Position
Unknown
AA seq 125 aa
MHLSQLLACALLLTLLSLRPSQAKPGAPPKAPRTPPGEEVTETQASGGGQKKGDKAPGGA
NLKGDGSRLLRDLRVDTKARAAWSPRLMHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSR
SGLGC
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcacctctcccagctgctggcctgcgccctgctgctcacactgctctcgctccggcct
tcccaagccaagcccggggcgccaccgaaggccccacgcaccccgccgggagaggaggtg
accgagacccaggcttcaggtggcggtcagaaaaagggcgacaaagctcccgggggcgcc
aatctcaagggtgacggatcgcgactgctccgggacctgcgcgtggacaccaaggcgcgg
gcagcgtggtctcctcgccttatgcacgagcaccccaacgcgcgcaaatacaaaggaggc
aacaagaagggcttgtccaagggctgcttcggcctcaaactggaccggatcggctccagg
agcggcctgggatgttag

DBGET integrated database retrieval system