KEGG   Loxodonta africana (African savanna elephant): 100672439
Entry
100672439         CDS       T04351                                 

Gene name
TLR3
Definition
(RefSeq) toll-like receptor 3
  KO
K05401  toll-like receptor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100672439 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100672439 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100672439 (TLR3)
   05160 Hepatitis C
    100672439 (TLR3)
   05171 Coronavirus disease - COVID-19
    100672439 (TLR3)
   05164 Influenza A
    100672439 (TLR3)
   05168 Herpes simplex virus 1 infection
    100672439 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100672439 (TLR3)
   05165 Human papillomavirus infection
    100672439 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:lav04054]
    100672439 (TLR3)
   04090 CD molecules [BR:lav04090]
    100672439 (TLR3)
Pattern recognition receptors [BR:lav04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100672439 (TLR3)
CD molecules [BR:lav04090]
 Proteins
  100672439 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD LRR_1 TIR LRR_9 TIR_2 LRR_6
Other DBs
NCBI-GeneID: 100672439
NCBI-ProteinID: XP_003412374
LinkDB
Position
Unknown
AA seq 914 aa
MVRISEGEVMSQGLPYRIYSFWGLLPLWMLCASSANKCVVRREVADCSHLRLTQVPADLP
ANITVLNLTHNQLRKLPPANFTRYSQLIILDGGFNSISKLESELCQKLPLLKVLNLQHNE
LSQLSDKTFVYCVNLTELHLTSNSIQKIKSNPFKNLKNLIKLDLAHNGLSSTKLGTELQL
ENLQELSLSNNKIHALRREELDFLGNSSLKKLELSSNQIKEFSSGCFHAIGKLSGLFLNN
IQLGSSLTEKLCLELSNTSIQSLSLSNTQLYRTSNMTFFGLKETNLTMLDLSHNSLNKIA
NDSFAWLPHLEYLTLENNNIEHLSSRSFYGLLNVRYLNLKRSFTKQSTSLASLPKIDDFS
FQWLKYLEHLNMEDNNFPGIKNNMFTGLIRLKYLSLSSSFTSLPTLTNETFLSLANSPLL
ILNLTRNKISKIESGAFSWLGHLEVLDLGLNEIGQELTGQEWRGLGNIVEIYLSYNKYLQ
LTSNSFALVPSLQQLMLRRVACKNVDISPSPFCSLRNLTILDLSNNNIANINEDMLEGLD
KLEILDLQHNNLARLWKHANPGGPVHFLKGLSHLHVLNLESNGFDEIPQGAFKDLSELKS
IDLGLNNLNILPPSLFDSQTSLKSLKLEKNLITSVEKNVFGPPFKNLTNLDMRFNPFDCT
CESIAWFVNWINGTHANISGLPDDYLCNTPPQYHGLSVTFFDTSACKDSAPFELLFVINT
STLLFFIFIVLLVHFEGWRISFYWNVSVHRILGFKEIDRQPEQFEYAAYVIHAHKDRDWV
WQHFSPMEEKDQSLKFCLEERDFEAGALELEAIVNSIKRSRKTIFVITQHLLKDPLCKRF
KVHHAVQQAVEQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSRCILNWPVQKERISAFH
HKLQVALGSRNSVY
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggtcagaataagtgaaggcgaagtcatgagccagggtttgccttatcgcatctactcc
ttttgggggctgttgcccctttggatgctgtgtgcttcctctgccaacaaatgcgttgtc
agacgtgaagtagctgactgcagtcacctcaggctgacccaagtaccggctgacctccct
gcaaacataacagtgctgaaccttacccacaatcaactcagaaaactgccacccgccaat
ttcacaagatacagccagcttattatcctggatggaggatttaactccatctcaaagctg
gagtcagagctgtgccaaaaactccccttgttgaaagtgttgaaccttcaacacaacgag
ctgtcccaactttctgacaaaacctttgtctactgcgtgaatttgacagaactccattta
acgtccaactcaattcagaaaattaaaagcaatccctttaaaaacctaaagaacttaatc
aaattagatctagctcataatggtttatcatctacaaaattaggaactgaactccagctg
gaaaatctccaagagctttcattgtcaaataataaaatccacgctttaagacgtgaagaa
cttgatttcttgggcaattcctctttgaaaaaattagagttgtcatcaaatcaaattaaa
gagttctcttcagggtgttttcatgcaattggaaaattatctggcctctttctgaacaac
atccaactgggctccagtctcacagagaagctgtgtttggaattatccaacacaagcatt
cagagcctatctctgagcaacacccagctctatagaacaagcaatatgactttttttgga
ctgaaggagacaaatctcaccatgcttgatctttcccataacagtttaaataagatagct
aatgattcctttgcctggcttccacatttggaatatctcaccctggagaataataacata
gagcatttgtcttctcgctccttttatgggctgctcaatgtgagatacctgaatttgaag
cgatcttttactaaacaaagtacttctcttgcttcacttcccaagattgatgacttttcc
tttcagtggctaaagtatttggagcaccttaacatggaagataacaattttccaggaata
aaaaacaatatgttcacaggattgatacgtctgaaatacttaagtctatccagctccttt
acgagtttgccaactttaacaaatgaaacatttttatcacttgcaaattctcctttactc
atactcaacttaaccagaaataaaatctcaaaaatagagagcggtgctttttcttggttg
ggccacctagaggtacttgaccttggcctgaacgaaattgggcaagaactcacaggccag
gaatggagaggtctaggaaatattgttgaaatctacctttcctataacaaatacctacaa
ctgactagcaattcctttgccttggttccaagccttcaacaactgatgctccgaagggtg
gcctgtaaaaatgtggatatctccccctcacctttctgctctcttcgtaacttgaccatt
ctggatctcagtaacaacaacatagccaacataaatgaggacatgttggagggtcttgac
aaactagaaattctggatttgcagcacaacaacttagccaggctctggaagcatgcaaac
cctggtggtcctgttcatttcttaaaaggtctttctcacctccacgtacttaacttagag
tctaatggctttgacgagatcccacagggggccttcaaggacttgtctgaattaaagagc
attgatttgggactgaacaatttaaacatacttccaccgtctctgtttgatagtcaaacc
tctctgaagtcattgaaacttgagaagaaccttataacatcagttgagaagaatgttttt
ggaccacctttcaagaatctgactaatttagatatgcgctttaatccatttgattgtacc
tgtgaaagtattgcctggtttgttaactggataaacggcacccacgccaacatctctggt
ctaccagatgattatctctgcaacactccacctcagtatcatggtttgtcggtgacattt
tttgatacatcagcctgcaaagacagtgccccttttgaactcctgttcgtaataaacacc
agtaccctattgttttttatcttcattgtactgctggtccattttgaaggctggaggata
tctttttactggaatgtttcagtacatcgaattcttggtttcaaagagatagacagacag
ccagagcagtttgaatatgcggcatatgtaattcacgcccataaagacagggattgggtc
tggcaacacttctccccaatggaagaaaaagaccaatcgctcaaattttgtctggaagaa
agggattttgaggcaggtgctcttgaacttgaagcaattgtcaatagcatcaaacgaagc
agaaagactatttttgttataacacagcacctattgaaagacccattatgcaaaagattc
aaagtgcatcatgcagttcagcaagctgttgaacaaaacctggattccattatactgatc
tttctcgaggagattccagattacaaactgaaccacgcactttgcttgcgaagagggatg
tttaaatctcgctgcatcttgaactggccagttcagaaagaacggataagcgcgtttcat
cataaactgcaagtagcgcttggatccagaaattcagtgtattaa

DBGET integrated database retrieval system