KEGG   Loxodonta africana (African savanna elephant): 100672459
Entry
100672459         CDS       T04351                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1 isoform X1
  KO
K16366  endothelin-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04270  Vascular smooth muscle contraction
lav04668  TNF signaling pathway
lav04916  Melanogenesis
lav04924  Renin secretion
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05200  Pathways in cancer
lav05410  Hypertrophic cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100672459 (EDN1)
   04066 HIF-1 signaling pathway
    100672459 (EDN1)
   04024 cAMP signaling pathway
    100672459 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100672459 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100672459 (EDN1)
   04916 Melanogenesis
    100672459 (EDN1)
   04924 Renin secretion
    100672459 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672459 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672459 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100672459 (EDN1)
   05410 Hypertrophic cardiomyopathy
    100672459 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100672459 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 100672459
NCBI-ProteinID: XP_023411580
LinkDB
Position
Unknown
AA seq 202 aa
MDYFPIIFSLLFVAFQGAPETAALGAELSTGAENEGGGPSPSAPWRPRRSKRCSCSSLMD
KECVYFCHLDIIWINTPEHIVPYGLGSPSRSKRSLKDLFPTKAANPRNRCQCTSQRDKKC
WNFCQAEKELRAQDTMEKGWNNPKKGNDCSKLGGKCIHQWLVEGRKLRRSEAISNSIKTS
FRIAKLKAELYREKKVMHNRTH
NT seq 609 nt   +upstreamnt  +downstreamnt
atggattatttccccataatcttctctctgctgtttgtggctttccaaggagctccagaa
acagcagctttgggcgctgagctcagcacgggtgctgagaacgaagggggcggcccctcg
cccagtgcgccctggcggccccgccggtccaagcgctgctcctgctcgtccttgatggat
aaggagtgtgtctacttctgccatctcgacatcatctggatcaacactcccgagcacatt
gttccatatggactgggaagtccttccaggtcaaagcgatccttaaaggatttatttcct
accaaggcagcaaaccccagaaatagatgccaatgtactagccaaagagacaagaagtgc
tggaatttctgccaagcagaaaaagaactcagggcccaagacactatggagaaaggctgg
aacaaccccaagaaaggaaacgattgttccaagcttggagggaagtgcattcatcagtgg
ctggtggaaggaagaaaactaagaaggtcggaggccatcagcaacagcatcaaaacgtct
tttcggatcgcgaagctaaaagctgagctctacagagagaagaaagtgatgcacaaccga
acgcactga

DBGET integrated database retrieval system