KEGG   Loxodonta africana (African savanna elephant): 100672525
Entry
100672525         CDS       T04351                                 

Gene name
KCNK3
Definition
(RefSeq) potassium channel subfamily K member 3
  KO
K04914  potassium channel subfamily K member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100672525 (KCNK3)
   04927 Cortisol synthesis and secretion
    100672525 (KCNK3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100672525 (KCNK3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100672525 (KCNK3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   100672525 (KCNK3)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 100672525
NCBI-ProteinID: XP_010590346
LinkDB
Position
Unknown
AA seq 401 aa
MYIMLVLLYFFLFVCTFHFLLVVAAVFDALESEPEFTDRRLLERRQLELRARYNLSQGGY
EELEGVVLRLKPHKAGLQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIP
LTLVMFQSLGERINTFVKYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFS
YYEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFL
NLVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGSSAGCGGGAGGSAHTTDTASSTAVAGG
GGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRY
SDTPSHRCLCSAAPRSAISSVSTGLHSLSTFRGLMKRRSSV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtacatcatgcttgtacttttgtacttttttcttttcgtgtgcacgtttcatttcctg
ctggtggttgccgcggtcttcgacgcacttgagtcggagcccgagttcaccgatcggcgg
ctgctggagcggcggcagctggagctgcgggcgcgctacaacctcagccagggcggttac
gaggagctcgagggcgttgtgctgcgcctcaagccgcacaaggccggcctgcagtggcgc
ttcgccggctccttctacttcgccatcaccgtgatcaccaccatcggctacggccacgcg
gctcccagcacggatggcgggaaggtgttctgtatgttctacgcgttgctgggcatcccg
ctcacgctcgtcatgttccagagcctgggcgagcgcatcaacaccttcgtgaagtacctg
ctgcaccgcgccaagaaggggctgggcatgcggcgcgccgacgtgtccatggccaacatg
gtgctcatcggcttcttctcgtgcattagcacgctgtgcatcggcgctgcggccttctcc
tactacgagcactggaccttcttccaggcctactactactgcttcatcacgctcaccacc
ataggcttcggcgactacgtggcgctgcagaaggaccaggcgctgcagacgcagccgcag
tacgtggccttcagcttcgtctacatcctcacgggcctcacggtcatcggagctttcctc
aacctcgtggtgctgcgcttcatgaccatgaacgccgaggacgagaagcgcgacgccgag
caccgcgccctgctcacgcgcaacgggcaggcgggcggcagcagcgcgggctgcggcggg
ggcgctggaggcagcgcgcacaccaccgacaccgcctcgtccaccgcggtggctggcggc
ggtggcttccgcaacgtgtacgccgaggtgctgcacttccagtccatgtgctcgtgcctg
tggtacaagagccgcgagaagctacagtactccatccccatgatcatcccgcgggacctc
tccacgtccgacacgtgcgtcgagcagagccactcgtcgccgggagggggcggtcgctac
agtgacactccctcgcaccgctgcctctgcagcgcggcgccgcgctccgccatcagctcc
gtgtctacgggcttgcacagcctgtccaccttccgcggcctcatgaagcgcaggagctcc
gtgtga

DBGET integrated database retrieval system