KEGG   Loxodonta africana (African savanna elephant): 100672596
Entry
100672596         CDS       T04351                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100672596 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100672596 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100672596 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672596 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100672596 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100672596 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100672596 (LAMA1)
   05414 Dilated cardiomyopathy
    100672596 (LAMA1)
   05416 Viral myocarditis
    100672596 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100672596 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100672596 (LAMA1)
   05145 Toxoplasmosis
    100672596 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_N Laminin_B Laminin_I Laminin_II Laminin_G_3
Other DBs
NCBI-GeneID: 100672596
NCBI-ProteinID: XP_023399926
LinkDB
Position
Unknown
AA seq 3530 aa
MRPKGPFLPSLGEQSEKQATTHYLKNPHLILGHQPRGGGRAGQPGRGPTAEGAGLEMRAR
GLLGRRRLQTAVRAGRVNRANTFSESTSPGRLERVFSSSQLTFSSHPHTRTRAAAAGQTN
HRVGERWTQVPTSGTPVPESGHRPRLSEQLASGPSPGGGSLCGGGVRGGGVSEGPEGREA
TAEPGTRQTALFWTPQSVAVFFQGAPGAAATCAAAARSWPRCSGWSCSASKEGLPGGGRE
GWGRPPSALAQPPWGHSFCRFAGLSVGVAEVGCCGREDGRAPTPLPSRASVPGSDCLVRG
RGGRAYTREPENEWERSSKSPSLSCGELRNRPRANRAGCSGLLEGRVPSWERPVRSASVS
ARVPQMASRARTRPPALRSLCSLPSGQPGSSRAQVRPWSPRGQVGAAKGGLCLLAARCSV
GENRKPERIFKISVRAERVKRDPLYLSQDNSNSIRRVKYYQRCCLLFGEFLLSGLFPAIL
NLASNAHISTNATCGEKGPEMFCKLVEHVPSRPVRNPQCRVCDGNSPNPKERHPISNAID
GTNHWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTKFS
PWQYYAVSDSECLTRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPS
ADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHREPKDLDPIVTRRYYYSIKDISIG
GMCICYGHASSCPWDETTKKLQCQCEHNTCGESCNKCCPGYHQQPWRPGTVSSGNTCEEC
NCHSKAKDCYYDENVANQQRSLNTAGQFQGGGVCINCQQNTMGINCETCIDGYYRPHKVS
PYEDNPCHPCDCDSVGSLSSVCIKDDLHSDSHNGKWPGQCPCREGYAGEKCDRCQFGYKG
YPHCVRCECSPAGSVNDDPCTEPCACKENVEGKHCDRCKSGFYNLKERNPQGCSECFCFG
VSDVCDSLSWTISQVNDMSGWMVTDLIGSNTIQSQQDSRGGLHQISINNSAVMQRLTSRY
YWSAPKAYLGNKLAAFGGFLKYTVSYDIPVEAVDSDLVSHADVIIKGNGLTLSTQAEGLS
LQPYEEYFSVVRLVPENFRDFSSKREIDRDQLMTVLANVTHLLIRANYNSAKMALYRLDS
VSLDTANPNVIDLALATEVEHCECPLGYSGISCESCLSGYYRVDGILFGGICQPCECHGH
ATECDIHGVCFACIHNTTGDHCEQCLPGFYGVPSRGTPGDCQPCACPLSTPSNNFSPTCH
VDDGDQVLCDQCAPGYTGAWCQRCADGYYGNPTVPGGSCTPCNCSGNVDPSEAGHCDSVT
GECLKCIGNTGGAHCERCAHGFYGDAVTAKNCRPCECHEKGSLSRVCHHETGLCDCKPHV
TGRQCDRCLNGYYGWSTGLGCRPCNCSASGSTSDDCTDEGQCHCVLGVAGERCDRCARGF
YAYQDGSCTPCDCAHTQNTCDPESGECICPPHTWGLKCEECEDGYWGRDLELGCKACNCS
SVGSASHQCDALTGRCQCKPAFEGPSCGRCTLGHRDFPACVSCDCDLRGTLVDTCDHEKG
LCSCEEETGTCSCKENVHGLQCSTCKMGTYALETGNPMGCTPCFCFGLSQSCAELEGYVR
VPVMLASDRPLLRVVSQSNLGGTTKGVYYQAPDILLDARTIRQHVQAEPFYWRLPDQFQG
DQLMAYGGRLRYSVAFYSVDGVGTSNFEPQVLIKGGRTRKQVIYMDAPAPENGMRQEQEV
GMKENFWKYFNSVSEKPVTRSDFMSVLSDIEYILIKASYGQGLQQSRISNISLEVGGKAE
ELHPGGEVASLLEHCLCPPGTAGFSCQNCAPGYHRGKLPEGGGRRPRPLIAPCVPCDCNN
HSQACDPETGKCLNCSGNTTGDHCDTCAPGFYGKVTGSAGDCALCTCPHSPPASFSPTCV
LEGHGDFRCDACFPGYEGQYCERCSLGYHGNPRVPGGSCQKCECSPRGSAHGSCDGISGQ
CVCRPGATGLRCDRCEPRHILVESDCVSCDDECVGVLLNDMDNIGDAILSVNLSGIIPVP
YGILSNLENTTKYLRESLLKENRQEKLAKIQLEDVTKQIQVLQKELAKVLTSSQHLNRAT
ERVFNRSGDLRAFIEKLQKSITEIIEKATTLNQTLDEKFQLPSSALQNMQENITSLLEAI
QKRQFMQLHQNATTELKAAEYLLSEIQKNYQKPQEELKVLQEAASSLLSKFSSDLQEAED
LVREAERKTQESSRLLPIINTNLREFKDKKLRVQEEQNLTSELIAKGRGLIDAASAHADA
AQNALTHLDHHRDELLLWNAKLRDHVDDLVMQMSRRRALGLVYRAEDHAAELKRLSGVLD
SGLENVRHVSLNATSAVHVHSNIQGLVEESETLANHALRAATQASLFSESLASNGKVALH
RSSKFLKEGSDLSKRHQGITLELSGLKRRVNKFQENADKITRQINESLLILRAIPEGVRD
KETNTTELAISANQSAASTLRDVVGLSQKLLSTSAVLSMVNATLQETNGLMRDSSEATLL
VGRKVKDVEAQANLLFDRLKPLKILEENLSRNLSEIKLLISQARKQAASIKVAVSADRDC
IRAYQPPISSTNYNTLRLHVKTSEPDNLLFYLGSSTSEDFLAVEMQRGKVAFLWDVGSGS
TRLEFSDFTIDDNKWHSIYVTRFGNTGLLSVKEMSSTQKPPTKTSKSPGTANVLDINNST
LMFVGGLGGQIKKSAAVKVTHFQGCIGEAVLNGNPIGLWNYIEREGTCHGCFGSPLNEDS
SFHFDGSGYSVMEKTLRATVTQIIMLFNTFSPNGLLLYLASDNTKDFLSIELVQGRVKVT
VDLGSGPLALITDRRYNNGTWYKIAFQRNRRQGLLAVIDAYNTSYKETKQGEAPGASSDL
NRLDKDPIYVGGLPSSRVIRKGLTSRSYVGCIKNLEISRSTFDLLRNSYGVRKGCALEPI
RSVSFLKGGYIELPPKSLSPESTLLATFATKNSSGLIMTGLGEDLEKQSRWQAHVPFFAI
MLIEGHIEVHVNSGDGTSLRRALLRSPTGTYGDGREHSISLIRSRRIITVQLDETSPVEM
RLGPLAESRTIDVSNLYVGGIPESEVAPVLKMRQSFHGCVGSLIFDTELLDFTSAVGYEQ
VDWDTCLLSEMPKLAHQGEDPELLLEPQPLPSPGQCAVDRAPDFVPDAHQFGLAQDSHFV
FPFDQSAVRKRLSVQLRLRTFASSGLIYYMAHQNQVDYATLQLHGGRLHFMFDLGKGRTR
VFHPTLLNDGQWHTVKTEYLKRKGFMTVDSLESPVVTTVGDGTTLDVEGKFYLGGLPAEY
RARNIGNITHSIPACIEEVTINSKPLDKGRPVSAFAVNKCYAVAEEGTFFEGSGYAALVK
EGYKVGSDVNISLEFRTSSGNGILLGISSTKVDAIGLEIVSGKLLFHVNNGAGRITATYE
PKARATLCDGKWHKLQANKSKHRVVLTVDGNAVRAESPHPQSTSADTNNPMYVGGYPADV
KQNCLTSKASFQGCLRKLTLTKGSQVQSYDFSKAFRLQGVFPHSCPGPEP
NT seq 10593 nt   +upstreamnt  +downstreamnt
atgaggcccaaaggacccttcctaccctccttaggtgagcagagtgaaaaacaagcgaca
actcattatttgaaaaatcctcacctaatcctcggccaccagccgaggggtggggggcgg
gctgggcagccaggccggggtcccaccgcggaaggcgccggcctggagatgcgtgcgcgc
gggctcctgggccggcggcggctgcagaccgcagtgagggcgggaagggtcaacagggca
aatactttctcggaatccaccagcccaggccgacttgagcgggttttctcctcctcccag
ctcactttctcttcccacccccacactcggacccgtgcggctgcagccggtcaaaccaac
cacagagttggggaacgctggacgcaggtccccacctcgggcactccggtccccgagagc
ggccaccgtccccgcctgtccgagcaactagcaagtggaccctcccccgggggagggtct
ctctgcggcggcggcgtgaggggcgggggtgtgtccgaggggcccgaggggcgggaggct
acagcggagccagggacgcggcagaccgcgctcttctggaccccgcagagcgtggccgtt
ttcttccagggcgcaccgggcgcggcggcgacatgcgcggcggcggcgcgctcctggcct
cgctgctctgggtggtcgtgcagtgccagcaaagagggtctcccgggcgggggccgagag
ggctggggacgccctccgagtgctttggcgcagcccccctggggccactcgttctgtcgg
tttgccggacttagtgttggggtggcggaagtgggatgctgcgggcgcgaggatgggagg
gcgccgaccccgctgccttcccgggcgtcagtccccggctcagattgtctcgtgcgggga
aggggtggccgggcgtacactcgggagccggagaatgaatgggaaaggagttctaagtcg
ccttcgttgtcctgcggcgagttgcggaaccgtccgcgggcgaacagggcaggctgctcg
gggctcctcgagggccgggtgccgagttgggagagaccggtgagaagcgcgtcggtctct
gcccgggtcccccagatggcgtccagggcccggacgcggccccctgcacttcgctctttg
tgcagtctcccaagtggccagcccggctcatcccgcgcccaagttagaccgtggtcaccc
cggggccaagtaggcgctgcgaagggcggactttgtctgctcgctgctaggtgcagtgtt
ggggagaatagaaaaccggagcgaattttcaagatttctgtccgtgctgagagagttaag
agagaccctctttacctttcccaggacaactccaactctatccgcagggttaagtattac
cagcgctgctgcttgttgtttggtgaatttttactttcaggcctgtttcctgccattctc
aatcttgccagcaatgctcacatcagcaccaatgcgacctgtggcgagaaggggcctgag
atgttctgcaagctcgtggaacacgtgcccagtcgccctgtgagaaatccacagtgcaga
gtctgtgatggcaatagccctaaccccaaagaacgacatccgatatcaaatgcgatagat
ggcaccaatcactggtggcagagtcccagtattcaaaacgggagagaataccactgggtc
actatcactctggacttgaggcaggtctttcaagtcgcatatgtcatcatcaaagctgct
aatgcccctcgacctgggaactggattttggagcgctccctcgatggcaccaagttctcc
ccctggcagtactatgcagtcagcgactcagagtgtttgactcgttacaatataactcca
agacggggcccgcccacgtacagggcagatgacgaagtgatctgcacctcatattactct
aggctggtgcctcttgagcatggagagattcatacatcactaatcaatggcagaccaagt
gccgatgacctttcacccaagttgctggaatttacttctgcccgatacatccgccttcgc
ttacagcgcattagaaccctgaatgcagatcttatgacccttagccaccgggagcctaaa
gatctggatcccattgttacacgacggtattactattcaataaaagacatttccattgga
gggatgtgcatttgctatggccatgccagtagctgtccatgggatgagactacaaagaaa
ctacagtgccaatgtgaacataatacctgtggggagagttgcaataagtgttgtcctgga
taccatcagcagccctggagacctgggaccgtttcttctggcaacacatgtgaagagtgt
aattgtcacagtaaagccaaggactgttactatgatgaaaatgttgcaaatcagcagaga
agtttgaatactgctggacagttccaaggaggaggagtttgtataaactgccaacagaac
accatggggatcaactgtgaaacctgtattgatgggtattacagaccacacaaagtttca
ccttatgaggataacccttgccatccctgtgactgtgactccgtggggtccctcagttct
gtctgtattaaggatgacctccattctgactcacacaatgggaagtggccaggtcagtgt
ccatgtagggaaggttatgcaggagaaaaatgtgatcgttgccaatttggctataagggt
tacccccactgtgttcgctgtgagtgcagtccggccggcagtgtgaacgatgacccctgc
acagagccttgtgcctgcaaggaaaatgttgaggggaaacactgtgatcgctgcaagtca
gggttctataacttgaaggagcgaaacccccagggctgctccgagtgcttctgctttggt
gtgtctgatgtctgcgacagcctttcttggaccatcagccaggtcaacgacatgtctggg
tggatggtcactgacttgatcggttcaaacacgatccagtctcagcaggattctcgtggt
ggacttcatcaaattagcatcaacaactctgcggtcatgcaaaggctgacttccaggtac
tattggtcagctcctaaggcatacctaggaaataagctggccgcgtttggtggattcctg
aaatacacggtgtcttatgatattccagtggaggcagtggacagtgacttagtgtctcac
gctgacgttatcattaagggaaatgggctcactctcagcacacaggcagagggcctgtca
ctgcagccctatgaggaatacttcagtgtggtcagacttgtgcctgagaacttccgggac
ttcagcagcaaaagggagatagatcgtgaccagctcatgactgtccttgccaatgtcaca
catctcttgatcagagccaactacaattctgcaaaaatggccctttacaggctggattct
gtctctctggacacagcaaaccctaatgttatagacctggccttggccactgaggtggag
cactgtgaatgtcccctaggctactcgggcatctcttgtgagtcatgcctctctggctat
taccgtgtggatggaatactctttggagggatttgccagccttgtgaatgccacggccac
gccaccgagtgtgatattcacggcgtttgctttgcttgtatacacaacaccacgggggac
cactgtgaacagtgcctgcctggcttctacggggtgccatcccgaggaacccctggagac
tgccagccctgtgcctgccctctctccacaccctccaacaatttcagccccacctgccac
gtggatgatggtgatcaagtgctgtgtgaccagtgtgccccaggatacacgggcgcttgg
tgtcagagatgtgcagacggttactatggaaacccaacagtgcctggaggatcctgcacc
ccgtgcaattgcagtggcaatgtggacccctcagaagctggccactgtgactcagtcacc
ggggagtgcctcaagtgcatcgggaacacggggggagcccactgtgaacgctgcgcccac
gggttctacggggacgctgtgacggctaagaattgccgcccgtgtgaatgccatgaaaaa
ggttccctgtctcgtgtttgccatcatgagactggactctgtgattgcaaaccgcatgtg
actggacggcagtgtgaccggtgcttgaatggctattacgggtggagcacagggctcggc
tgccggccctgtaactgcagcgcgtcagggtccacgtcggatgattgcacagatgaaggc
cagtgtcactgtgtcctgggagtggctggggaaaggtgtgacaggtgtgcacgtggcttc
tatgcgtaccaggatggcagctgcacaccctgtgactgtgctcacactcagaatacttgt
gatccagagtctggagagtgtatctgcccccctcacacttggggtttgaaatgtgaagaa
tgcgaggatgggtactggggccgtgacctggaactcggatgcaaggcctgcaattgcagc
agcgtggggtccgctagtcaccagtgtgatgcgctgacaggccgctgccaatgcaagcct
gcctttgagggcccaagctgtggccggtgcaccctgggccacagagactttccggcctgt
gtttcctgtgactgtgacctgagggggacgttggtggacacctgtgatcacgaaaagggc
ctttgcagctgtgaagaggaaaccggtacctgctcttgcaaggaaaatgtccatggcctt
cagtgcagcacatgtaaaatgggcacctatgctcttgagactggcaaccccatggggtgc
accccgtgtttctgtttcgggctgtcacagtcctgtgcagagttggagggctacgtgagg
gtcccagtaatgctggcctcagaccggcctcttctgcgtgtggtctctcagagtaacctg
gggggcacgaccaagggagtctattaccaggcccccgacatcttactggatgccaggacc
atccggcagcacgtccaggcagagcccttttactggcggctgcccgatcagttccaggga
gaccagctcatggcctacggtggcagactgaggtacagcgtggccttctattctgtggat
ggtgttggcacctctaactttgagcctcaagtcctcatcaaaggaggccggaccagaaag
caagtcatttacatggacgcacccgcacccgagaatggcatgagacaggaacaagaagtg
ggaatgaaagagaacttttggaaatattttaactctgtttctgaaaagcctgtaacccgc
tcagacttcatgtctgttcttagcgacattgagtacatcctcatcaaggcctcatatggt
caaggactacagcagagcagaatctcaaacatttcactggaggtgggcggtaaggctgag
gagctgcacccaggtggagaggtggcctccctcctagaacactgcctctgtcctccgggc
accgctggcttctcctgtcagaactgtgcccctgggtaccacagagggaagcttcctgaa
ggtggtggcagacgaccccgtcctctgattgctccctgtgtgccctgtgattgcaacaac
cacagtcaagcatgtgaccctgaaactggaaagtgtctgaactgcagcggtaacacgact
ggcgatcactgcgacacgtgtgcacctggcttctatgggaaggtgactggctcagctggc
gactgtgctctgtgtacctgcccacacagcccccctgccagctttagtcccacctgtgtc
ctggaaggacatggtgatttccgttgtgatgcctgttttccaggctacgaaggacagtat
tgtgagaggtgctccttgggctatcacgggaaccctcgagtcccagggggcagctgccag
aagtgtgaatgcagtccacgtggctcggcgcacggttcctgtgacggcatctccgggcag
tgtgtctgcaggccgggggccacggggctgcgatgtgaccggtgtgaacccaggcacatt
ctggtggagagcgattgtgtttcttgtgatgatgaatgtgtaggtgtgctgttgaatgac
atggataacattggtgatgccattctttctgtgaacctcagtggcatcattcctgtcccg
tatggaatcttgtcaaacctggaaaatacaaccaaatatctcagggaatctttattaaaa
gaaaatagacaggagaagctggcaaaaattcagctggaagacgtcacaaaacagatccag
gtcttgcaaaaagagcttgccaaagtgttaacaagtagccaacacttgaacagggcgact
gaaagagtcttcaacaggagtggagacctcagggcatttattgagaagctgcagaaaagt
atcacagaaattattgaaaaagcaacaactctaaatcagaccttggatgaaaaatttcag
ctgcccagctccgctcttcagaatatgcaagagaacattacatctttgctggaagccata
cagaaaaggcagttcatgcagttacatcaaaatgccaccacggagctcaaagctgcggaa
tatctgctgtcagaaattcagaagaattaccagaagccacaggaagagttgaaggtatta
caagaagcagccagcagcctcctttcaaaattcagcagtgacctgcaggaggcagaagac
ctggtgcgtgaagcagagaggaagacccaggaaagcagccgcctgctgcccattatcaac
accaacctgagagaattcaaggataaaaagctgcgtgttcaagaagagcaaaacttgact
tcagagctaatagcgaaagggagaggattgatagatgctgccagtgcacacgcagacgcc
gcccaaaatgctctgactcatttagaccatcaccgggatgagctacttctatggaatgcc
aaactcagggatcatgtagatgatttggtcatgcagatgtccagaagaagagcacttgga
cttgtctacagagctgaggatcatgctgctgagctcaaaagactatcaggtgttctggac
agtggcctggaaaatgtcagacatgtgtccttgaatgctaccagtgcagtccatgtccat
tccaacattcaaggcctggtggaagaatcagagacactggcaaaccacgctctcagggcc
gcaacccaggccagcctgttctcagaatcccttgcttcaaatgggaaagtggctctccat
cgcagttccaaatttctaaaagaaggcagcgacctgagtaagaggcatcaaggtattaca
ttggaattgagtggtttgaaaagaagagtaaacaaatttcaagagaatgctgataaaatt
accaggcagatcaatgaatctctcttgatccttagagcaatcccagaaggtgttagagac
aaagaaaccaacaccaccgagctggctatctctgcaaaccagagtgcagcaagcacgctg
agggacgttgtgggtttgagccaaaagctgctgagtacatcggctgtcctgtccatggtg
aatgccacattacaagaaacaaacggactcatgcgcgactcctcagaggccactctgtta
gttggaagaaaagttaaagatgtggaagcacaagccaaccttttatttgatcggttgaag
cctttgaagatattagaagagaacctgagcagaaacctatcagaaattaaactgctgatc
agccaagcccggaaacaagcagcttctattaaagttgctgtgtctgcagacagagactgc
atccgggcctaccagccgccaatttcctccaccaactacaacaccttaaggctacacgtt
aagaccagcgaaccggacaacctcctgttctacctcgggagcagcaccagcgaggatttc
ctggccgtggagatgcagcgtggaaaggtggccttcctgtgggatgtgggctccgggtcc
acacgactggaattttcagacttcacaattgatgacaacaaatggcatagtatctatgta
accagatttggaaacactggtttactgagcgtaaaggaaatgagctcaactcaaaaacca
ccaacaaaaacaagtaaatcccctggaacagctaacgtcctggatataaacaattcaaca
ttaatgtttgttggaggacttggaggacaaatcaagaagtctgctgctgtgaaggttact
cacttccaaggctgcataggagaggccgtcttgaatggaaaccccattggcctgtggaac
tatatcgaaagggagggcacatgccatggctgctttggaagtcccctgaatgaagattcc
tcgttccattttgacggaagcggctattctgtcatggaaaagaccctccgggcgacggtg
acacagataatcatgctgtttaataccttttccccgaatgggctgcttctctacctcgct
tcggataacaccaaagacttcttatccatcgagctggtccagggcagagttaaagtcaca
gttgacctgggttcaggacctcttgctcttattacggacagacgatataacaacgggacc
tggtacaaaatcgccttccagcgaaaccgaaggcaaggactcctagcagttattgatgcc
tataacaccagttataaagaaaccaaacaaggtgaagctccaggggcatcttccgacctc
aatcgcctagataaggatccaatttacgttggtggattacctagttcaagagttataagg
aaaggcctcaccagcagaagctatgtgggctgtatcaaaaacttagaaatatctagatcg
acctttgatttgctcagaaattcctatggagtgagaaaaggctgtgcactggagcctatc
cgaagtgttagcttcttgaaaggcggctacattgagttgccacccaagtctttgtcacca
gaatcgaccttgttggcaacatttgccaccaagaacagcagtggcctcatcatgactggc
cttggcgaggacctggaaaagcagagccgatggcaggcacatgtgcccttctttgccatc
atgctgattgaaggccacattgaagtgcacgttaattctggggacggaacaagcctgaga
cgagctctcctgcgttctcctacgggcacttacggtgatgggcgagagcactccatctcc
ctgattaggagtagaagaattatcactgtccagctggatgagaccagccctgtagaaatg
aggctgggcccgttagcagaaagcaggacaatagacgtgtccaacctgtacgtagggggc
attccggagagtgaggtggcccctgtgctgaaaatgcggcagtccttccacggctgcgtc
ggaagcctgatctttgacacggaacttctagacttcactagtgcagttggctatgaacaa
gtggactgggacacctgcttactttcagaaatgcctaaactggctcatcaaggagaggac
cccgagcttctgctagaacctcaacctctacccagtccggggcaatgtgcagtggacaga
gccccagactttgttcccgatgctcaccagtttggcctggcacaggacagccattttgtg
tttcctttcgatcagtctgctgttagaaagaggctttcagttcagctcaggcttcgaaca
tttgcctccagtggtctgatctactacatggctcatcaaaaccaagttgactatgccaca
ctccagctccatggcggccgcctccatttcatgtttgaccttggcaaaggaaggacaaga
gtcttccaccccacgctgctcaatgatggccagtggcacacggtcaagacagagtacttg
aaaagaaagggcttcatgactgttgacagcctagaatccccagtggtgacgacagtggga
gatggcactacgttggatgtggaaggaaagttctacctgggagggcttcccgctgagtac
agggccagaaacattggaaatatcacccacagcatccctgcctgcattgaggaggtgacc
attaatagcaagccgctggacaagggccgcccagtatctgcctttgcagtgaacaagtgc
tatgcagtggcagaggaaggaactttctttgaaggaagtggatatgctgctcttgtcaaa
gaaggctacaaagtcgggtcagatgtaaacatcagcctggagttccgtacctcctcgggg
aacggcatcctcctggggatcagcagcaccaaagtggatgccattggattagagattgtc
agtggcaagcttttgtttcatgttaacaatggtgccgggaggataacagccacatatgag
cccaaagctagggctactctctgtgatgggaaatggcacaaactccaagcaaacaaaagc
aaacaccgcgtggttctgactgtcgatgggaatgcagttcgtgctgaaagcccacacccc
cagtccacctcggcagataccaacaaccccatgtatgtcggtggctatcctgctgatgtg
aagcagaactgcctaaccagcaaagcctcgttccagggctgcttgagaaagctcactctg
acgaagggctcacaagtgcagtcctacgacttcagcaaagctttccgcctacaaggagtt
ttcccacattcctgtcctgggcctgagccctga

KEGG   Loxodonta africana (African savanna elephant): 100677404
Entry
100677404         CDS       T04351                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100677404 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100677404 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100677404 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677404 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100677404 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100677404 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100677404 (LAMA2)
   05414 Dilated cardiomyopathy
    100677404 (LAMA2)
   05416 Viral myocarditis
    100677404 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100677404 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100677404 (LAMA2)
   05145 Toxoplasmosis
    100677404 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 Laminin_EGF Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 LXG DUF948 Cep57_MT_bd DUF1664
Other DBs
NCBI-GeneID: 100677404
NCBI-ProteinID: XP_023413930
LinkDB
Position
Unknown
AA seq 3097 aa
MPLCSGPHVFTCLSFLGLFPAVLNLASNAVITTNATCGEKGPEMYCKLVEHVPGQPVRNP
QCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIV
KAANSPRPGNWILERSLDDVEYKPWQYHAVTDSECLTLYNIHPRTGPPSYAKDDEVICTS
FYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLRFQRVRTLNADLMMFAHK
DPREIDPIVTRRYYYSIKDISVGGMCICYGHARACPLDPETNKSRCECEHNTCGDSCDQC
CPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIRGKYLGGGVCINC
TQNTAGINCETCIDGFFRPKGVSPKYPRPCQPCHCDPTGSLNEVCVKDEKHARRGLAPGS
CHCKSGFGGVSCDRCARGYTGYPSCQSCNCSGIGSRNEDPCFGPCNCKENVEGGDCSSCK
PGFFNLQEDNHKGCDECFCSGVSNRCQSSYWTYSNIQDMSGWYLTDISGRIRVAPQQDDF
DAPQQTSINNAEARLRLPQSYYWSAPAPYLGNKLTAAGGQLTFTISYDLEEEEEDTERAL
QLMIILEGNGLRISTAQDEVYLLPSEEHINVLSLKEELFTIHGTNVPVSRKEFMTVLANL
KRLLIQTTYSLGMDAIFRLSSVILESAVPYPTDGSIAAAVEVCQCPPGYSGSSCESCWPR
HRRVNGTIFGGICEPCQCFGHAESCDDVTAECVNCKDHTSGPYCNECLPGFYGDPTKGTS
EDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPVGYTGPRCERCAEGYFGQPSIPGGS
CQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCN
VNGSFSEVCHARTGQCECRPNVQGWKCNECKPETFGLQSARGCVPCNCNSFGSKSFDCEE
SGQCWCQPGVTGKKCDHCAHGYFKFQEGGCTACDCAHLGNNCDPKTGRCICPPNTVGEKC
SKCVPNTWGYSIISGCKVCNCSLVGSLDIQCNINTGQCKCHPKFSGAKCTECKLGHWNYP
HCDLCDCFLPGTDGTTCDTETKKCSCSDQTGQCTCKMNVEGVHCDRCRPGKFGLDAKNPL
GCSSCYCFSATSQCSEAKGLIRTRVTLNPEQTILPLVDEALQHTTTKGIAFQHPEIVAHM
DLVKQDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYNPQVIIRGGTP
AHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTVTREDFLDVLYDIHYILI
KATYGNIMRQSRISEISMEVAEKGRVTAVTPRAHLIEKCDCPLGYSGLSCETCLPGFYRL
PSELGGRTPGPTLGTCVPCQCNGHSSLCDPETSKCQNCQHHTGGDFCERCALGYYGIVKG
SPNDCRQCACPLISSSNNFSPTCVMEGLDDYRCSACPRGYEGQYCERCAPGYTGSPRSPG
GSCQECECDPHGSLPVPCDPVTGLCTCRPGATGQKCDGCKHWHAREGMECVFCGDECTGL
LLGDLARLEQMAMSINLTGPLPAPYKMLYSLENTTQELKHLLSPQRAPERLIQLAEGNLN
TLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELVQDAEAVNDKAAKLND
TLGAQDKAFERNLQGLQKEIDQMMTELRRKNLDTQKEAAEDELVAAEALLKKVKKLFGES
RGKNEEMEKDLREKLADYNNKVDDAWDLLREATDKIREANRLSTANQKNMTALEKMKEAL
ESGKRQTENTLKEGNDILDEANRLADGINSVIEYVEDIQTKLPPMSEELKDKIDGLSREI
KDRNLAEKVSQAENHAAELNDSSTVLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKV
AEEAKGLANEATELATGPQGLLKEGAKASLQKSFRILNEAKKLANNVKENDDHLNGLTNR
LENASVRNGELLKALNDTLGKLSAIPNDTAVKLQAVKDKARQANDTAKDVLAQIKDLHQN
LDGLKKNYNKLADSIAKTNAVIKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELED
NLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNHIVINVKTAVADN
LLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIEASRTGRNG
TISVRALDGPKASIVPSTYSSVSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTG
CMGETYFDSKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIRWYPNI
STVMFKFRTFSSSALLMYLATRDLKDFMSVELTDGRIKVSYDLGSGMASVASNQNHNDGK
WKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKADDKIYFGGLPTLRNLRP
EVNLRKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVELAPVPIN
VGTEINLSFSTKNESGVILLGSGGTPAPPRRKRRQTGQAYYAIFLNKGRLEVHLSTGART
MRKIVIKPEPSLFHDGREHSVHVERTRGIFTVQVDEDRRHVQNMTVEQAIEVKKLFVGGA
PLEFQPSPLRNIPPFEGCIWNLVINSVPMDFAQPVSFKNADIGRCADQKPPEDEDGAVPA
EILILPEPVPTPAFPTPTPVLAHGPCAVDSEPALLLGSKQFGLSKNSHIAIAFDDTKVKN
RLTIEFEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSYDLGSGDTKTMIPTKINDG
QWHKIKIMRIKQEGILYVDDASNRTISPKKADILDVVGMLYVGGLPINYTTRRIGPVTYS
IEGCIRNLQMAEAPADLEKPTSSFHVGTCFADAQKGTYFDGTGFATAVGGFKVGLDLLVE
FEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVYDAGIPGRLCDGQW
HKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDGLNQFGLTTNIRFR
GCIRSLRLTKGTGKPLEVNFAKALELRGVQPVSCPAN
NT seq 9294 nt   +upstreamnt  +downstreamnt
atgccactttgttctggaccacacgtattcacttgtctgtcttttttaggtttatttcct
gctgtgctgaatcttgcttctaatgctgtcatcaccaccaatgcaacatgcggagaaaaa
ggacctgaaatgtactgcaaattggtagaacacgtccctggacagcctgtgaggaaccct
caatgtcgaatctgcaatcaaaacagcagcaatccctaccagagacacccgattacaaat
gcgattgatggaaagaacacttggtggcagagccccagtattaagaatggaattgaatac
cattatgtgacaattacactggatttacagcaggtgttccagattgcatatgtgattgtg
aaagcggctaactcccctcggcctggaaactggatcttggaacgctctcttgatgacgtt
gaatacaagccatggcagtatcatgctgtgactgactcggagtgcctaaccctctacaat
atacatccccgcacagggccaccgtcatatgccaaggacgatgaggtcatctgcacttcg
ttttattccaagatacaccctttagaaaatggagagattcacatctctttgatcaatgga
agaccaagtgctgatgacccttctcctgaactgctggaatttacctcagctcgctatatt
cgcctgagatttcagagggtccgcaccttgaatgctgatttgatgatgtttgcccacaaa
gacccaagagaaattgaccccattgtcacaagaagatattactactccatcaaggatatt
tcggtcggagggatgtgcatctgctatggtcatgccagggcttgtccgcttgatccagag
acaaataaatcccgttgtgaatgtgagcataatacatgtggtgatagctgtgatcagtgc
tgtccaggattccatcaaaaaccttggagagctgggacttttctaactaaaactgaatgt
gaagcatgcaattgccatgggaaagctgaagaatgctattatgatgaaaatgttgccaga
agaaatctgagtttaaatatacgtggaaagtaccttggagggggtgtgtgcattaattgt
acccaaaacactgccggcataaactgtgagacatgtattgatggcttcttcagacccaaa
ggggtgtctccaaagtatccaagaccatgtcagccatgtcattgtgatccaactggttcc
ttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtctggcacctggatcc
tgtcattgcaaaagtggctttggaggggtaagctgtgatcgatgtgccaggggttacact
ggctaccccagttgccaatcctgcaactgcagtggcataggaagcagaaatgaggaccct
tgttttggaccctgtaactgcaaggagaacgttgaaggtggagactgcagtagttgcaaa
cctggcttcttcaatttgcaagaggataaccataaaggctgtgatgagtgtttctgttca
ggggtttcaaacagatgtcagagttcctactggacctacagcaatatacaagacatgagt
ggctggtacctgactgacatctctggccgcatccgagtggctccgcagcaggacgacttt
gatgcaccccaacagaccagtatcaataatgcagaggccagactaaggttgccacagagc
tactactggagtgccccagctccctatctgggaaacaaactcacagcagctggaggacaa
ttgacattcaccatatcatatgacctagaagaagaggaagaagatacagaacgtgcactc
cagcttatgattatcttggagggaaatggcttgcgcatcagcacagcccaagatgaggtg
tacctgctaccatctgaagaacatattaatgttctgtcacttaaagaagaattatttacc
atacatggcacaaatgtcccagtcagcagaaaagaatttatgacagtgcttgcgaattta
aagagactcctcatacaaaccacatacagccttgggatggatgccatcttcaggttgagt
tctgttatccttgaatccgctgttccctatcctactgacggaagcattgcagcagctgtg
gaagtttgtcagtgtccaccagggtatagtggttcctcttgtgaatcttgttggcctcgg
catagacgagttaacggcacgatttttggtggcatctgcgagccatgtcaatgctttggt
catgcagagtcctgtgacgacgtcactgcagaatgcgtgaattgtaaagaccacacaagt
ggcccatactgcaatgaatgtcttcctggtttctatggtgatcctactaaaggtacctct
gaagactgtcaaccctgcgcctgtcctctcaatatcccatctaataactttagcccgacg
tgccatttagaccggagtcttggattgatctgtgatgaatgccctgtcgggtacacaggc
ccacgctgtgaaaggtgtgcagaaggctattttggtcaaccatctatacctggaggatca
tgtcagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgacagc
ttgtctggctcctgtctgatatgtaaaccaggtacaacaggccgctattgcgagctctgt
gccgatggatattttggagacgcggttgatgcaaagaactgtcagccctgtcgctgtaac
gtcaacggctccttctccgaggtttgccacgctcggacagggcagtgtgaatgcagaccc
aatgtgcagggatggaagtgcaatgagtgcaagcctgaaactttcggcctacagtcagca
agggggtgtgtgccctgcaactgtaattccttcgggtctaaatcttttgattgtgaagag
agtggacaatgctggtgccagcctggagtaacaggaaagaaatgtgaccattgtgcccat
ggctatttcaaattccaagaaggaggatgcacagcttgtgactgtgctcatctgggtaat
aattgtgaccccaagactggtcgatgcatttgccctcccaatactgttggagagaaatgt
tctaaatgcgtacccaacacctggggctacagcattatcagtggatgtaaggtttgcaat
tgcagtttggtgggatctcttgatatccagtgcaatataaacacaggccaatgcaaatgt
catccaaaattctccggtgcaaaatgtacagagtgcaagctaggtcactggaattaccct
cattgcgacctctgtgactgcttcctgcctgggactgacggcacgacctgtgacacagag
actaagaaatgttcatgtagcgatcagactggccagtgtacatgcaagatgaacgtggaa
ggtgtccactgtgacaggtgccggcctggcaaatttggacttgatgccaagaacccactt
ggttgcagcagctgctattgcttcagtgctacttctcagtgctctgaagcaaaaggactg
atccgtacgcgggtaacactgaaccctgagcagaccattctgccacttgtggatgaggca
ctgcagcacacaactaccaagggcattgcttttcagcacccggagatcgttgcacacatg
gacctggtgaaacaagatctccatttagaaccattttattggaaacttccagaacaattt
gaaggaaagaagttgatggcctatggtggcaagctcaagtatgcaatctattttgaggct
cgggaagaaacaggtttctctacttataatcctcaagttatcattcgaggtgggactcct
gctcatgctagaattattgtcagacacatggctgctcctctaattggccaattgacaagg
catgaaattgaaatgacagagaaagaatggaaatattatggtgatgatcctcgaatcagt
aggactgtgacccgagaagacttcttggatgtactgtacgatattcattatattcttatc
aaggctacttatgggaatatcatgcgacaaagcaggatttctgaaatctcaatggaggta
gctgaaaaaggacgtgtgacagcagtgactcctcgagctcacttgatagaaaaatgtgat
tgtcccctgggctattctggcttgtcctgtgagacatgcttgccaggattttatcgactg
ccttctgaactgggtggccgcacccctggaccaaccctgggcacctgtgttccatgtcag
tgtaatggacacagcagcttatgtgaccctgaaacgtccaaatgccagaattgtcagcat
cacactggtggtgacttctgtgaacgttgtgccctcggatactacggaattgtcaaagga
tcaccaaatgactgtcggcaatgtgcttgccctctgatttcttccagcaacaatttcagt
cctacttgtgtcatggaaggtcttgatgattaccgctgcagtgcttgtccacggggatat
gaaggccagtactgtgaaaggtgcgcccctggctatactggaagtccaagaagcccagga
ggttcctgccaagaatgtgagtgtgacccccatggctcacttcctgtcccttgtgaccca
gtcacagggctctgcacgtgccgacctggagccacagggcagaagtgtgacggctgcaag
cactggcatgcgagagagggcatggagtgtgttttttgtggagatgagtgcacgggcctt
cttctcggtgacttggctcgcctggaacagatggccatgagcatcaacctcactggtccg
ctgcctgctccctataaaatgctgtacagtctcgaaaacacgactcaagaactaaagcac
ttgctctcacctcaacgggccccagaaagactcattcagttggcagagggcaatctgaat
acactcgtgacagaaatgaatgagcttctgaccagggctaccaaagtgacagcagatggc
gagcaaactggacaggatgctgagaggaccaacacgagagcaaagtctttaggagaattc
attaaggagctcgtccaggatgcagaagctgtaaatgacaaagctgcaaaactaaatgac
actctgggagctcaagacaaggcctttgagagaaatttgcaaggacttcagaaagagatt
gatcagatgatgacagaattgaggaggaaaaatctagatacacaaaaggaagccgctgaa
gatgagttggtagctgcagaagcccttctgaagaaagtgaagaagctgtttggagagtct
cgggggaaaaatgaagaaatggagaaggatctccgtgagaaactggctgactacaacaac
aaagtggatgatgcttgggacctattgagagaagccacagataaaatcagagaagctaat
cgcttgtctacagcaaaccagaaaaacatgacagctttggagaaaatgaaggaggctctt
gaaagtggcaaacggcaaactgagaacactttaaaagaaggcaatgacatacttgatgaa
gccaaccgtcttgcagatggaatcaactcagtgatagaatatgttgaagacattcaaact
aaattgccaccaatgtctgaagagcttaaagataaaatagatggcctctcccgtgaaatc
aaagacaggaatcttgctgagaaggtgtcccaggccgaaaaccatgctgctgagttgaat
gactcctctactgtccttgatggaatccttgatgaagctaaaaacatttccttcaatgcc
actgcggccttcaaagcttacagcaatattaaggactatattgatgaagcagagaaagtt
gccgaagaagccaaaggtcttgcaaatgaagctacagaactggcaacaggtcctcagggc
ttattgaaagaaggtgccaaagcctctcttcagaaaagcttcaggattcttaatgaagcc
aagaagttagcaaataatgtaaaagaaaatgatgatcacctgaatggcttgacaaacagg
ttagaaaatgccagtgttagaaatggggagctcctgaaagccttgaatgacactttggga
aagttatcagccattccaaatgatacagccgtgaaactgcaagctgttaaggacaaagca
agacaagccaatgacacagcaaaagatgtactggcacagattaaagacctccaccagaac
ctcgatggcctgaagaaaaattacaataaactagcggacagcatagccaaaacaaatgct
gtgataaaagatccttctaagaacaaaatcattgcagatgcagacgccactgtgaaaaat
ttagaacaagaggctgatcgactaatagataaactcaaacctatcaaggaacttgaggat
aacctgaagaaaaacatttctgagataaaagaactgataaaccaagctaggaaacaagcc
aattctatcaaagtatctgtgtcttctggaggtgactgcattcgaacatacaaaccagaa
atcaagaaaggaagctacaatcatatcgttatcaatgtcaagacagctgttgctgacaat
cttcttttttatcttggaagtgccaaatttattgactttctggctatagaaatgcgtaaa
ggcaaagtaagcttcctttgggatgttggatctggagttggacgtgtagaatatccggat
ttgactattgatgactcatattggtaccgtattgaagcatcaagaactgggagaaatgga
acaatttcggtgagagccctggatggacccaaagccagcattgtgcccagtacatacagt
tcagtctcaccaccagggtatactatcctagatgtggatgcaaacgcaatgctgtttgtt
ggtggcttgactgggaagctaaagaaggccgatgccgtacgcgtgatcacattcactggc
tgtatgggagagacatactttgacagtaagcccatagggttgtggaatttccgagaaaaa
gaaggtgactgcaaaggatgtacagtcagtcctcaggtggaagatagtgaggggactatt
cagtttgatggagaaggttatgcattggtcagccgccctattcgctggtatccaaacatc
tccaccgtcatgttcaagttcaggacattttcttcaagtgctctcctgatgtatcttgcc
acacgagacctgaaagattttatgagtgtagagctcactgatgggcgcataaaagtcagc
tatgatctgggttcaggaatggcttccgttgccagcaatcaaaaccataatgacgggaaa
tggaaatcattcaccctgtcaagaattcaaaaacaagccaatatatcaattgtagacata
gatactaaccaggaggagaacatagcaacttcatcatctggaaacaactttggtcttgac
ttgaaagcagatgacaaaatatattttggcggcctaccaacactgagaaacttgaggccg
gaagtaaatttgcggaaatattctggctgcctcaaagatattgaaatttcaagaacccca
tataatatactcagtagccctgattatgttggcgttaccaaaggatgttcactggagaat
gtttacaccgtaagcttccctaagcctggttttgtggagttggcccctgtgccaattaat
gtaggaacagaaatcaacctgtccttcagcaccaagaatgagtctggggtcattctcttg
ggaagtggagggacaccagcaccacctagaagaaaacgaaggcagactggtcaggcctat
tatgcgatattcctgaacaaaggccgtctggaagtgcatctctccacaggcgcacgaaca
atgaggaaaatcgtcatcaaaccagagccgagtctgtttcacgacgggagagaacattcc
gttcatgttgagagaactagaggcatctttactgttcaagttgatgaagacagaagacat
gtgcaaaacatgactgtggaacaggctattgaagttaaaaagctttttgttgggggtgct
ccactggaatttcaaccttcccccctcaggaacattcctccttttgaaggctgtatatgg
aacctagttattaactccgtccccatggactttgcacagcctgtatccttcaaaaatgca
gacattggtcgctgtgcagatcagaagccccctgaggatgaagatggagcagttcctgct
gagatacttatcctcccagagccagttcccacacctgccttccctacacccaccccagtt
ctggcacatggtccttgtgctgtagattcagaaccagcccttttgctggggagtaagcag
tttgggctttcaaaaaatagtcacattgcaattgcatttgatgacaccaaggttaagaac
cgcctcacaattgagtttgaagtgcgaaccgaagctgaatcgggattgcttttttacatg
gctcggatcaatcatgctgactttgctactgttcagctgagaaatggattgccctacttc
agttatgacttgggaagtggtgacaccaaaaccatgatccccaccaaaatcaatgatggc
cagtggcacaagattaagattatgcgaattaagcaagaaggaattctttatgtagatgat
gcctccaacagaaccatcagtcccaagaaagctgatatcctggacgttgtaggaatgcta
tatgttggagggctgcccatcaactatactacccgaagaataggtccagtcacctacagc
attgagggctgcatcaggaatcttcagatggcagaggcccctgctgaccttgaaaagcca
acctccagcttccatgtcgggacatgttttgcagatgctcagaagggaacatacttcgat
ggaacaggttttgccacagcagttggtggattcaaggtgggattggaccttcttgtagaa
tttgaattccgcacaactaggaccactggagttcttctgggaattagcagccaaaaaatg
gatggaatgggtatcgaaatgattgatgaaaagctcatgtttcatgtggacaatggagcc
ggccgattcactgctgtctatgatgctgggatcccagggcgtttgtgtgatggacagtgg
cataaggtcactgccaacaagatcaaacaccgcatcgagctgacggttgatgggaaccag
gtggaagcccaaagcccaaacccagcttctacatcagctgacacaaatgaccctgtgttt
gttggaggtttcccagatggcctcaatcagtttggcctgacaaccaacattcggttccga
ggttgcatccgatccctgaggctcaccaaaggaactggcaagccactggaggttaatttt
gccaaagccttggagctgagaggtgttcaacctgtatcgtgcccagccaactga

DBGET integrated database retrieval system