KEGG   Loxodonta africana (African savanna elephant): 100672607Help
Entry
100672607         CDS       T04351                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00020  Citrate cycle (TCA cycle)
lav00310  Lysine degradation
lav00380  Tryptophan metabolism
lav01100  Metabolic pathways
lav01200  Carbon metabolism
Module
lav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lav_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100672607 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    100672607 (OGDHL)
   00380 Tryptophan metabolism
    100672607 (OGDHL)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100672607 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 100672607
NCBI-ProteinID: XP_003408973
LinkDB All DBs
Position
Unknown
AA seq 1010 aa AA seqDB search
MSPLRLLVSRLGAQATRLLGPHDVQVVSWQRRSSGPQATFSSSRGGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFRKASEEASSGLVQPQPPLVIPKSRSALSGGTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLREADLDKEFQLPTTTF
IGGSESTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGIMQFSSQEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMRIETVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRATNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDLEGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADRLIAEGTVTLQ
EFEEEIAKYDRICEEAFGRSKDKKILDIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDT
LTHIGTVASSVPLEGFKIHTGLSRILRGRADMTKNRTVDWALAEYMAFGSLLQEGIHVRL
SGQDVERGTFSHRHHVLHDQDVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDRMVSGTSFQRVIPEDGAAAQAPEQVRRLIFCTGKVYYDLVK
ERSSQGLEEQVAITRLEQISPFPFDLVKQEAKKYPGAELVWCQEEHKNMSYYDYISPRFM
TILSRARHIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLKAFEGKTF
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagtccactccggctactggtgtcccggcttggtgcacaggccacaaggctcctgggc
ccacatgatgtccaggtggtcagctggcaacgcaggtcctctgggccccaggccaccttc
tccagcagcagaggtggaggcggctccagttacatggaggagatgtacttcgcctggctg
gaaaacccccagagtgtccataagtcctgggacagcttcttccggaaagccagtgaggag
gcgtctagtggcctggtgcagccacagccacctttggtcatccccaagagcaggtcggca
ctttcaggcgggaccaagaccagcaagctggtggaggaccacctggcagtgcagtcgctg
atccgggcctaccagatccggggccaccatgtggcccagctggaccccctgggcattctg
gatgcagacctggactccttcgtgccctcagatttaatcacaaccatcgataagttggcc
ttctatgatctgcgggaggctgacctagataaggagttccagctgcccacaaccaccttc
atcgggggctcagaaagcaccctgtctctgcgggagatcattcggcgcctggagagcacc
tactgccagcacattggcttggagttcatgttcatcaacgatgtggagcagtgccagtgg
atccggcagaagtttgagacccctggtatcatgcagttctccagccaggagaagcggacc
ctgctggcccggctagtgcgctccatgaggtttgaagacttcctggcccgcaagtggtcc
tcagagaagcggtttggcctggagggctgtgaggtcatgattcctgccttgaagaccatc
atcgacaaatccagtgagatgaggatcgagaccgtcatcctggggatgcctcacaggggc
aggctgaacgtgctggccaacgtgatccgcaaggacctggagcagatcttctgccagttt
gaccccaagctggaggcagcagatgagggctccggggatgtcaaatatcacctgggcatg
taccatgagaggatcaatcgggctacaaataggaatatcactctgtcactcgtggccaac
ccatcccatctggaggctgtggaccctgtggtacaagggaagacaaaggctgagcagttc
taccgtggggacttggagggcaagaaggtcatgtccattctggtgcatggagatgctgcc
tttgctggtcagggtgtggtctacgagaccttccacctaagcgacctgccctcctacact
accaatggcactgtgcacgttgtcgtcaacaaccagattggctttactacggacccccga
atggcccgttcctcaccgtaccccactgatgtggcccgtgtggtcaacgcacccatcttt
catgtgaacgcggatgacccagaggcagtgatatacgtgtgcagtgtggcagctgagtgg
aggaacaccttcaacaaagatgttgttgtggacctggtctgctaccgccggcgtggccac
aatgagatggacgaacccatgttcacgcagccgctcatgtacaagcagatccacagacag
gtgcctgtgctgaagaagtatgcagacaggctcattgctgagggcaccgtcacccttcag
gaatttgaggaggaaatcgccaagtatgaccggatctgtgaggaggcatttggcagatcc
aaggacaagaagatcctggatataaagcactggctggactccccctggccgggctttttc
aacgtggacggggagcccaaaagcatgacgtgcccagccaccggcattcctgaagacaca
ctgacccacattggaactgtggccagctctgtgcccctggagggcttcaagatccacaca
ggcctttctcgcatcctgcggggccgggcagacatgaccaagaaccgaacagtggactgg
gcgctggcagagtacatggccttcggctctctccttcaggagggtatccatgtgcggctg
agcgggcaggacgtggagaggggcacatttagccaccgccaccatgtcctccatgaccag
gacgttgaccggaggacgtgtgtccccatgaaccacctctggcctgaccaggccccctat
accgtgtgcaacagctccctctcggaatatggagtcctgggctttgagctgggctatgcc
atggccagccccaacgccctggtgctctgggaggctcagtttggtgacttccacaacacg
gcccagtgcatcatcgaccagttcatcagcactggccaggccaagtgggtgcggcacaat
ggcatcgttctgctgctgccccatggcatggaaggcatgggcccagagcactcctcggcg
aggcctgagaggttcctgcagatgagcaatgatgactcagatgcctaccccgtgttcacc
gaggactttgaggtgagccagctctacgactgcaactggattgtggtcaactgctccacg
ccggccagctacttccacgtgctgcgccggcagatcctgctgcccttccgcaagccgctg
atcatcttcacacccaaatctctgctgaggcacccggaagccaagtccagctttgaccgt
atggtgtctgggaccagctttcagagagtgatccctgaggatggggccgcagcacaggct
cctgagcaggtgcgccggctcatcttctgcacgggcaaggtgtactatgacctggtgaag
gagcggagcagccagggcctggaggagcaggtggccatcacacgcctggagcagatctct
ccattcccctttgacctggttaagcaggaggcaaagaagtaccccggcgcagagctggtc
tggtgccaggaggagcacaagaacatgagctactatgactacatcagcccgcgcttcatg
accatcctgagccgggcacggcacatctggtatgttggccgtgacccagcagctgcaccg
gccacaggaaacaggaacacacacttggtgtcactgaagaagtttttggacactgccttc
aatcttaaggcctttgagggcaagacgttctag

DBGET integrated database retrieval system