KEGG   Loxodonta africana (African savanna elephant): 100672699
Entry
100672699         CDS       T04351                                 

Gene name
LHB
Definition
(RefSeq) lutropin subunit beta
  KO
K08521  lutropin subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04917  Prolactin signaling pathway
lav04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100672699 (LHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100672699 (LHB)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100672699 (LHB)
   04912 GnRH signaling pathway
    100672699 (LHB)
   04913 Ovarian steroidogenesis
    100672699 (LHB)
   04917 Prolactin signaling pathway
    100672699 (LHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 100672699
NCBI-ProteinID: XP_010584816
LinkDB
Position
Unknown
AA seq 147 aa
METLQGLLLWLLLGGVWASRGPLRPLCRPINATLTAEKEACPVCITFTTSICAGYTLCTP
APTYGFQVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPMVSFPVALSCWCGPCR
LSSSDCGGPRAQPVACDSPHFPGLLLF
NT seq 444 nt   +upstreamnt  +downstreamnt
atggagacactacagggcctgctgctgtggctgctgctggggggggtgtgggcatccagg
gggccacttcggccactgtgtcggcccatcaacgccaccctgactgcggagaaagaggcc
tgccctgtctgtatcaccttcaccaccagcatctgtgccggctacaccctgtgcacccct
gcccccacctatggcttccaggtgcgggtgctgccagctgccttgccacctgtgccccag
cctgtgtgcacataccgtgagctgcgctttgcctccgtccggctgcctggctgcccacct
ggcgtggaccccatggtctccttccctgtggccctcagctgctggtgtgggccttgtcgc
ctcagcagctctgactgcgggggccccagggcccagcctgtggcctgtgacagtccccat
ttcccaggcctcctcctcttctaa

DBGET integrated database retrieval system