KEGG   Loxodonta africana (African savanna elephant): 100672848
Entry
100672848         CDS       T04351                                 

Gene name
NR0B1
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear receptor subfamily 0 group B member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100672848 (NR0B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100672848 (NR0B1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100672848 (NR0B1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    100672848 (NR0B1)
Nuclear receptors [BR:lav03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   100672848 (NR0B1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep
Other DBs
NCBI-GeneID: 100672848
NCBI-ProteinID: XP_010598038
LinkDB
Position
Unknown
AA seq 473 aa
MAGEDHQWQGSILYNMLMSAKQTRAAPEAPQAQLQGQCWGCSCGAGQQGGREGLLGGRPX
ALTYRCCFCVTTTRARAASFYNMLTSAKQVHAAPERQAPLRGPCWGLLVRTEPPVAERGS
WAGQAVTLLYRCCFCGEGHPRQGSILYNMLTSAKXTHVAPVAPEALQGAPWWGRPYGAQR
PGGREGLPDGRAMELLYRYCFCGVDHPHQGSKLYHLPTSAKQTHAALEAPAPLPGTPWWG
SWCGAQRPVALKSPQLVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRSCWAPLLLL
ELAQDRMHLETVETSEPSMLQRMLTTRRREIAGYVAPPLPTAQPVLAPPPETGQLPSVAE
VQAIKGFLAKCWSLNISTKEYAYLKGTVLFNPDLPGLHCVKYIQGLRWGTQQILNEHIRM
THRGHQARFAELSCALSLLRFINANVVAELFFRPIIGTVSMDDMMLEMLCAKL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgggtgaggaccaccagtggcagggcagcattctctacaacatgctcatgagcgcg
aagcaaactcgcgcggctccggaggcgccccaggcgcagctacagggccagtgctggggc
tgctcctgcggcgcggggcagcaggggggcagagaggggttgctgggcgggcggccgnnt
gcgctcacgtaccgctgctgcttctgcgtgacgaccacccgcgccagggcagcatccttc
tacaacatgctcacgagcgcaaaacaagtgcatgcggctcccgagcgccaggctccactg
aggggtccgtgctgggggctgctcgtgcgcaccgagccgcccgtggcagagaggggctcc
tgggcggggcaggctgtgacgctcctgtaccgctgctgcttctgcggtgaaggccacccg
cgccagggcagcatcctctacaacatgctcacgagcgccaagncaacgcacgtggctccg
gtggcgcccgaggcgctgcagggggccccgtggtggggccgcccctacggcgcacagagg
ccggggggccgagaggggctgccggacgggcgggccatggagctcctgtaccgctactgc
ttctgcggtgtcgaccacccgcaccagggcagcaagctctaccacctgcccacgagtgcg
aagcaaacgcacgcggctctggaggcgcccgcacctctgccggggaccccatggtggggc
tcctggtgtggcgcgcagcggcctgtggccctcaagagcccccagttggtctgcgaagcg
gcctcggctggcctgttgaaaacgctgcgcttcgttaagtatttgccctgcttccaggtg
ctgcccctggaccagcagctggtgctggtgcgcagctgctgggcgccactgctcctgctg
gagctggcccaggaccgcatgcacttggagacggtggagacctccgagcctagtatgctg
cagaggatgctcaccaccaggcggcgggagatcgcgggctacgtggcaccacccctgccc
acggcgcagccagtgttggcaccgccgccggagaccgggcagctgccgtcggtcgcggag
gtccaagccatcaagggcttccttgccaagtgctggagcctgaatatcagtaccaaggag
tacgcctacctcaaggggaccgtgctttttaaccctgacctgccaggcctgcattgtgtg
aagtacatccagggacttcgatggggaactcagcagatactcaacgaacacatcaggatg
acgcacagagggcaccaggccagattcgcggaactgagttgtgccctctccctgctgaga
ttcatcaatgccaatgttgttgctgaactgttcttcaggccaatcattggcacagtgagc
atggatgatatgatgctggaaatgctctgtgcgaagctatga

DBGET integrated database retrieval system