KEGG   Loxodonta africana (African savanna elephant): 100672942
Entry
100672942         CDS       T04351                                 

Gene name
AIP
Definition
(RefSeq) AH receptor-interacting protein isoform X1
  KO
K17767  AH receptor-interacting protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100672942 (AIP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100672942 (AIP)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100672942 (AIP)
SSDB
Motif
Pfam: FKBP_C TPR_2 TPR_8
Other DBs
NCBI-GeneID: 100672942
NCBI-ProteinID: XP_003419594
UniProt: G3SVY4
LinkDB
Position
Unknown
AA seq 330 aa
MADIIARLREDGIQKRVIQEGRGDLPDFEDGTKATFHYRTLHSDDEGTVLDDSRARGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDVKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGIAQMHEHSTLGHADLDALQQNPRPLIFDIEMLKVENPGTYQQDPWAMTDEEKAKAVP
VIHQEGNRLYREGHVKEAATKYYDAIACLKNLQMKEQPGSPDWIQLDQQITPLLLNYCQC
KLVAEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALGP
IVSRELRALEARIRQKDEEDKARFRGIFSH
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcggatatcatcgcaagactccgggaggacgggatccaaaagcgtgtgatacaagag
ggccgaggagacctccctgactttgaggatggaaccaaggccaccttccactaccggaca
ctgcacagtgatgatgaaggcaccgtgctggacgacagccgggcgcgtggcaaacccatg
gagctcatcattggcaagaagttcaagctgcccgtgtgggagaccatcgtgtgcaccatg
cgcgaaggggagatcgcccagttcctctgcgatgtcaagcacgtggtcctgtacccactg
gtggccaagagcctgcgcaacattgctgccggcaaggaccccctggaggggcagcggcac
tgctgtggcatcgcccagatgcacgagcacagcactctgggccacgccgacctggacgcc
ctgcagcagaacccccggcctctcatctttgacattgaaatgctgaaggtggagaacccc
ggcacataccagcaggacccatgggccatgacggatgaggagaaggccaaggcagtacca
gtcatccaccaggagggcaaccggttgtaccgtgaggggcacgtgaaggaggctgccacc
aagtactacgacgccatcgcctgccttaagaacctgcaaatgaaggaacagcctgggtcc
cctgactggatccagctggaccagcagatcaccccgctgctgctcaactactgccagtgc
aagctggtggccgaggagtattacgaggtgctggaccactgctcctccatcctcaacaag
tatgatgacaatgtcaaagcctacttcaagcggggcaaggcccatgcagccgtgtggaat
gcccaggaggcccaggctgactttgccaaggtgctggagctggacccagccctggggcca
attgtgagccgtgagcttcgggccctggaggcacggatccggcagaaggacgaggaggac
aaggcccgtttccggggcatcttctcccactga

KEGG   Loxodonta africana (African savanna elephant): 100677666
Entry
100677666         CDS       T04351                                 

Gene name
AIPL1
Definition
(RefSeq) aryl-hydrocarbon-interacting protein-like 1
  KO
K17767  AH receptor-interacting protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100677666 (AIPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100677666 (AIPL1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100677666 (AIPL1)
SSDB
Motif
Pfam: TPR_2 TPR_1 FKBP_C TPR_11 TPR_8 TPR_12 ANAPC3
Other DBs
NCBI-GeneID: 100677666
NCBI-ProteinID: XP_003416764
UniProt: G3TJV4
LinkDB
Position
Unknown
AA seq 328 aa
MDAALLLNVEGIKKTILHGGTGDLPNFITGSRVTFHFRTTKCDEERTVIDDSKQVGQPMH
IIIGNMFKLEVWEILLTSMHISEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTAWHVHT
CGLANMFAYHTLGYEDLDELQKEPQPLIFVIELLQVEAPSEYQRETWNLSNVEKMQAVPI
LHGEGNRLFKLGRYEEASAKYQEAIVCLRNLQTKEKPWEVQWLKLEKMTNTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLQKVLELEPSMRKA
VRRELQLLESRLEEKREEERLRCRNMLG
NT seq 987 nt   +upstreamnt  +downstreamnt
atggacgctgcgctgctcttgaacgtggaggggataaagaagactattctgcacgggggc
acgggggacctcccaaatttcatcactggatcccgagtgacctttcacttccgcaccaca
aaatgcgacgaggagcggacggtgatagatgacagcaagcaggtgggccagcccatgcac
attatcattggaaatatgttcaagctggaggtctgggagatcctgctgacgtccatgcac
atcagtgaggtggccgagttctggtgtgacaccatccacacaggggtctaccccatcctg
tccaggagcctgcggcagatggcagagggtaaggaccccactgcgtggcacgtgcacacg
tgcgggctggccaacatgtttgcctaccacacgttgggctacgaggacctggacgagctg
cagaaggagccacagccgctgatcttcgtgattgagctgctgcaggtggaggccccgagc
gagtaccagagggagacctggaacctgagcaatgtggagaagatgcaggcggtgcccatc
ctacacggagaaggcaaccggctcttcaagctgggccgctatgaggaggcttccgccaag
taccaggaagccatcgtctgcctgcggaacctgcagaccaaggagaagccctgggaggtg
cagtggctgaagctggaaaagatgaccaacaccctgatcctcaactactgccagtgcctg
ctgaagaaggaggagtactacgaggtgctagagcacaccagcgacatcctgcggcaccac
ccaggcattgtgaaggcctactacgtgcgcgcccgggctcacgcggaggtgtggaacgag
gcggaggccaaggcggacctccagaaagtgctggagctggagccgtccatgcggaaggcc
gtgcgcagggagctgcagctgctggagagccgcctggaggagaagcgcgaggaggagcgg
ctgcgctgtcggaacatgctgggctag

DBGET integrated database retrieval system