KEGG   Loxodonta africana (African savanna elephant): 100673077
Entry
100673077         CDS       T04351                                 

Gene name
CRH
Definition
(RefSeq) LOW QUALITY PROTEIN: corticoliberin
  KO
K05256  corticotropin-releasing hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04730  Long-term depression
lav04934  Cushing syndrome
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100673077 (CRH)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    100673077 (CRH)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100673077 (CRH)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100673077 (CRH)
SSDB
Motif
Pfam: CRF
Other DBs
NCBI-GeneID: 100673077
NCBI-ProteinID: XP_023401822
LinkDB
Position
Unknown
AA seq 193 aa
MRLTLLMSAGVLLVALLPCPPCRAFLSRGLDSGARQAPQHPQPLDFFQPPPQPQQSQQPQ
ARPVLLRMGEEYFLRLGNPNKSPAAPLSPASSPLAGGSRPSPEEAANFFRALLQQLPLPR
RSLNSPASPGEHEVESALGGHQEAAERKRRSEEPPISLDLTFHLLREVLEMARAEQLAQQ
AHSNRKLMEIIGK
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcggctgacgctgctcatgtccgcgggcgttctgctggtggctttgctgccctgcccg
ccttgcagggccttcctcagccgggggcttgactccggcgcccggcaggccccgcagcac
ccccagcccctggatttcttccagccgccgccgcagccccagcagtcccagcagcctcag
gctcggcccgtcctgctccgcatgggggaagaatacttccttcgcctggggaaccccaac
aagagccccgctgctcccctctcgcctgcctcctcgcccctcgccggcggcagccgcccc
tcgccagaagaggcggccaactttttccgcgcgttgctgcagcagctgccgctgccccgg
cgctcgctcaacagccccgcgagtcccggggagcacgaagtcgagagcgccctgggcggc
caccaggaggcagcggagaggaagaggcggtccgaggagcctccgatctcgctggatctc
accttccacctcctccgagaagtcctggaaatggccagggctgagcagttagcgcagcaa
gctcacagcaacaggaaactgatggagattattgggaaatga

DBGET integrated database retrieval system