KEGG   Loxodonta africana (African savanna elephant): 100673196
Entry
100673196         CDS       T04351                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04110  Cell cycle
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05212  Pancreatic cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100673196 (RB1)
   04218 Cellular senescence
    100673196 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673196 (RB1)
   05203 Viral carcinogenesis
    100673196 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100673196 (RB1)
   05225 Hepatocellular carcinoma
    100673196 (RB1)
   05226 Gastric cancer
    100673196 (RB1)
   05214 Glioma
    100673196 (RB1)
   05220 Chronic myeloid leukemia
    100673196 (RB1)
   05218 Melanoma
    100673196 (RB1)
   05219 Bladder cancer
    100673196 (RB1)
   05215 Prostate cancer
    100673196 (RB1)
   05224 Breast cancer
    100673196 (RB1)
   05222 Small cell lung cancer
    100673196 (RB1)
   05223 Non-small cell lung cancer
    100673196 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100673196 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100673196 (RB1)
   05161 Hepatitis B
    100673196 (RB1)
   05160 Hepatitis C
    100673196 (RB1)
   05163 Human cytomegalovirus infection
    100673196 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673196 (RB1)
   05169 Epstein-Barr virus infection
    100673196 (RB1)
   05165 Human papillomavirus infection
    100673196 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100673196 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100673196 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100673196 (RB1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100673196 (RB1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100673196 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 100673196
NCBI-ProteinID: XP_010590921
LinkDB
Position
Unknown
AA seq 816 aa
MPFTFTELQKNIETSVCKFFDLLKEIDTSTKVDNAVSRLSKKYNVLCALYSKLERTCELI
YLTQPSSSISSEINSVLVLKLSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPP
ALLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCTEHECNIDEVKNVY
FKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYRKNKDLDARLFLDHDKTLQADPIDSFE
TQRTPRKSNPDEEVNMIPPQTPVRAVMNTIQQLMTILNSASDQPSENLISYFNNCTVNPK
ESILKRVRDIGCIFKEKFARAVGQGCAEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQN
FSKLLNDNIFHKSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVI
ESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSRDREGPADHLEPACAL
NLPLQNNHTAADMYLSPLRSPKKKGPTPRVNSPPSAEAQAAPAFQTQKPLKSTSLSLFYK
KVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGIC
KVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQKLKTNILQYA
STRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRIL
VSIGESFGTSEKFQKINQMVCNSDRMLKRNAEESNPPKPLKKLRFDIEGSDEADGSRHLP
GESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEDK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgccattcacttttactgagctacagaaaaacatagaaaccagtgtctgtaaattcttt
gacttactaaaagaaattgataccagtaccaaagttgataatgctgtgtcaagactgtcg
aagaagtataatgtattatgtgcactctacagcaaattagaaaggacatgtgaacttata
tatttgacacaacccagcagttcgatatcttctgaaataaattctgtgttggtgctaaag
ctttcttggatcacgtttttactagctaaaggggaagtattacaaatggaagatgatctc
gtgatctcatttcagttaatgctgtgtgtccttgactattttatcaagctctcaccccct
gcattgcttaaagaaccatataaaacagctgtgatacctattaatggttcacctcgaaca
ccaagacgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgatacaaga
attattgaagttctctgtacagaacacgaatgtaatatagatgaggtgaaaaatgtttat
ttcaaaaattttataccttttatgaattctcttggaattgtagcttctaatggacttcca
gaggttgaaagtctctctaaacaatatgaagaaatttaccgtaaaaataaagacctagat
gcaagattatttttggatcatgacaaaactcttcaggctgatcctatagacagctttgaa
acacagagaacaccacgaaaaagtaaccctgatgaagaggtgaatatgattcctccgcag
actccagttagggctgttatgaatactattcagcaattaatgacgatcttaaattcagca
agcgatcaaccatcagaaaacctgatatcctattttaataactgcacagtgaatccaaag
gaaagtatcctgaaaagagtaagggatattggatgcatctttaaagagaaattcgctaga
gctgtgggacagggatgtgctgaaattggatcacagcgatacaaacttggagtccgattg
tattaccgagtaatggaatccatgcttaaatcagaagaagaacgattatccattcaaaac
tttagcaaactcctgaatgacaacatctttcataagtctttgttggcgtgcgcgcttgag
gttgtaatggctacatatagcagaagtacatctcagaatcttgattctggaacagatttg
tccttcccctggattctgaatgtacttaatttaaaagcctttgatttttacaaagtgatt
gaaagttttatcaaagcagaagccaacttgacaagagaaatgataaaacatttagaaaga
tgtgaacatcgaatcatggaatcccttgcatggctctcagattcacctttatttgatctt
attaaacaatcaagggaccgagaaggaccagctgatcatcttgaacctgcttgtgccctc
aaccttcccctccagaataaccacactgcggcagatatgtatctttctcctctaagatcc
ccaaagaaaaaagggccaactccgcgtgtaaattctcctccaagtgcagaggcacaagca
gccccagccttccagactcagaagccgctgaaatctacctccctttcactcttttacaaa
aaagtatacaggctagcatatctccgccttaataccttgtgtgcgcgccttctgtctgac
cacccagagctagaacacatcatctggacccttttccagcacaccctgcaaaatgagtat
gaactcatgagagacaggcatttggaccagatcatgatgtgttctatgtatggcatttgc
aaagtgaagaatattgaccttaaattcaaaatcattgtaacagcgtacaaggaccttcct
cacgctgtccaggagacattcaaacgtgttttgatcagagaagaggaatatgattccatt
atagtattctataactctgtcttcatgcagaaactgaaaacaaatattttgcagtatgct
tccacaaggccccctaccttgtcaccaatacctcacattcctcgaagcccttataagttt
tctagttcacctttacggattcccggagggaacatctatatatcacccctgaagagtcca
tataaaatttcagaaggcctgccaactccaacaaaaatgactccaagatcaagaatcttg
gtatcaattggtgaatcatttgggacttctgagaagttccagaaaataaatcagatggtg
tgtaacagcgaccgtatgctcaaaagaaatgccgaagaaagcaaccctcctaaaccactg
aaaaaactacgctttgatattgaaggatcagatgaagcagatggaagtagacatctccca
ggggagtccaaatttcagcagaaactggcagaaatgacatctactcgaacacgaatgcaa
aagcagaaaatgaatgacagcatggatacctcaaacaaagaggacaaatga

DBGET integrated database retrieval system