KEGG   Loxodonta africana (African savanna elephant): 100673202
Entry
100673202         CDS       T04351                                 

Gene name
SGCG
Definition
(RefSeq) gamma-sarcoglycan isoform X1
  KO
K12564  gamma-sarcoglycan
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100673202 (SGCG)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100673202 (SGCG)
   05414 Dilated cardiomyopathy
    100673202 (SGCG)
   05416 Viral myocarditis
    100673202 (SGCG)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 100673202
NCBI-ProteinID: XP_003414076
UniProt: G3SXW0
LinkDB
Position
Unknown
AA seq 291 aa
MVREQYTTTAEGTHIERPEDQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKV
MWFSPMGMGHLHVTKDGLRLEGESEFLFPLYAEEIHSRMDSSLLLQSTQNVTVNARNSEG
EVTGRLKVGPKMVEVQSQQFQINSKDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVE
TPLVQADPFQELRLESPTRSLSMDAPRGIHIEAHAGKIEALSQMDIKFHSSDGMLVLDAE
TVCLPKLVQGTGGPSGSSQRLYEICVCPDGKLYLSVAGVGTTCPENSHVCL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggtacgtgagcaatacactacaaccgcagaaggcacccacatagagaggccagaggac
cagtatgtctataaaattggcatttatggctggagaaagcgttgcctctacttatttgtt
cttcttttactcatcatcctagttgtgaatttggctcttacgatttggattcttaaagtg
atgtggttttccccaatgggaatgggtcatttgcatgtaacaaaagatggacttcgcctg
gaaggggaatcagaatttttattcccattgtatgccgaagaaatacactccagaatggac
tcctctctgcttctccaatcaactcaaaatgtgactgtgaatgcccgcaactccgaagga
gaggtcacaggcagattaaaagtgggtcccaaaatggtggaagtccagagtcaacagttt
cagatcaactccaaggatggcaagccactatttacagttgatgaaaaggaagttgtagtt
ggtacagataaacttcgagtaactggtcctgaaggggctctttttgaacattcagtggag
acaccacttgttcaagctgacccgtttcaagagcttaggttagaatcccctacaaggagt
ctaagcatggatgcacccaggggcattcatattgaagcacatgctgggaaaattgaggcc
ctctctcaaatggatatcaaatttcatagtagtgatggaatgcttgtgctggatgctgaa
actgtatgtctgcccaagttggttcaagggactgggggtccctctggcagctcacagaga
ctctatgaaatctgtgtttgtccagatgggaaactttacctgtctgtggctggtgtgggt
accacgtgcccggaaaacagccatgtctgtctctaa

DBGET integrated database retrieval system