KEGG   Loxodonta africana (African savanna elephant): 100673235
Entry
100673235         CDS       T04351                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9 isoform X2
  KO
K04693  interferon regulatory factor 9
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100673235 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100673235 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100673235 (IRF9)
   04625 C-type lectin receptor signaling pathway
    100673235 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100673235 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100673235 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100673235 (IRF9)
   05171 Coronavirus disease - COVID-19
    100673235 (IRF9)
   05164 Influenza A
    100673235 (IRF9)
   05162 Measles
    100673235 (IRF9)
   05168 Herpes simplex virus 1 infection
    100673235 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673235 (IRF9)
   05169 Epstein-Barr virus infection
    100673235 (IRF9)
   05165 Human papillomavirus infection
    100673235 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100673235 (IRF9)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100673235 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100673235
NCBI-ProteinID: XP_003421047
LinkDB
Position
Unknown
AA seq 441 aa
MASGKARCTRKLRNWVVEQVESGKFPGVCWDDEAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGNSEGPATWKTRLRCALNKSSEFQEVPERGRMDGAEPYKVYRLLPPGTL
LAEPGTQKSPSKRHHSSESSDREEDESPAKSHVLSPFLLQDPFNNERGTSGGADHSDTGS
SGSSSSGSSGSNSNSNSPKPQEGTDTTEAPFEGDQASVEFVLPPDLDYSLLLTFIYNGRV
VGETQVHTLDCRLVAEPSDSQSSMKQVVFPKADPLEPTQRVLSQLKRGVLMASNPKGLFV
QRLCPIPISWDAPQTPPGPGPHLLPSNECVELFKTAYFYRDLARYNQGLGPPPKFQVTLN
FLEESSDPSQNPQSLITVQMEQAFARHLLERTMPEEQAATLPLSLEDPPAFPSLFFLSPL
NRNILHTGDLNSSVIILGDCL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcatcaggcaaggcacgctgcacccgaaagctccggaactgggtggtggagcaggtg
gagagcggcaagttccctggggtatgctgggatgatgaagctaaaaccatgttccggatt
ccctggaagcatgcaggcaagcaagacttccgggaggaccaggatgctgccttcttcaag
gcctgggcgatattcaagggaaagtacaaggagggaaactcagaaggccctgccacctgg
aagactcgcctgcgctgtgccctcaacaagagttctgaatttcaggaggtccctgagagg
ggccgtatggatggggctgagccctacaaggtgtatcggttgctgccaccaggaaccctc
cttgcggagccaggcacccaaaaatccccatcaaagcgacaccacagttccgagtcctcg
gacagggaggaggatgagagtcccgcgaagagccacgtactcagccccttcttgcttcag
gaccccttcaataatgagaggggaaccagtgggggagcagaccattcagacactgggagc
agcggcagcagtagcagcggcagcagcggcagcaacagcaacagcaacagccctaagcct
caggaaggcacagacacaactgaggccccctttgaaggggatcaggcatctgtggaattc
gtgctccctccagacttagactactcgctgctgctcaccttcatctacaatgggcgcgtg
gttggggagacccaggtgcacaccctggactgccgccttgtggctgagccctcggattcc
cagagcagcatgaagcaagtggttttccccaaggctgacccactggagcccacacagcgc
gtgctgagccagctcaagaggggcgtcctgatggccagcaaccccaaaggcctcttcgtg
cagcgcctctgccccatccccatctcctgggatgcgccccagaccccacctggtccaggc
ccacatctgctgcccagcaatgagtgcgtggagctcttcaaaacagcctacttctacaga
gacttggccaggtacaaccagggcctgggccccccacccaagttccaggtgaccctgaat
ttcttggaggaaagttctgaccctagccaaaacccacagagtcttattacagtgcagatg
gagcaagcctttgcccgacatttgctggagaggacaatgccagaggagcaggcagccact
ctgcccctgagcctggaggatccccccgccttcccatctcttttcttcctctctccttta
aacagaaatattctccacactggtgacctgaactcctctgtgataattctcggtgattgt
ctgtga

DBGET integrated database retrieval system