KEGG   Loxodonta africana (African savanna elephant): 100673301
Entry
100673301         CDS       T04351                                 

Gene name
ARHGEF11
Definition
(RefSeq) rho guanine nucleotide exchange factor 11 isoform X1
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04928  Parathyroid hormone synthesis, secretion and action
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100673301 (ARHGEF11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100673301 (ARHGEF11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673301 (ARHGEF11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100673301 (ARHGEF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100673301 (ARHGEF11)
Membrane trafficking [BR:lav04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100673301 (ARHGEF11)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 RGS PH_13 PH
Other DBs
NCBI-GeneID: 100673301
NCBI-ProteinID: XP_010593148
LinkDB
Position
Unknown
AA seq 1567 aa
MSVRLPQSIDRLSSLSSLGDSASERKSPSHHHEPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPAPAGGPRVTPMIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQ
ILRNMLRQEEKELQRICEVYNRNPASLLEEQIEGARRRVSQLQLKIQQETGGLVDVLPLY
GDTSQRSSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMA
RMAQHHRRQGSDAPVPPSSDQGVDQSPKPLIIGPEEDYDPGYFNNEGNIIFQDLEKLKSR
PAHLGVFLRYILSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDIRSVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLD
GDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSYAGIRLREARPSNPAEKAQ
SAPDKDKWLPFFPKTKKQSSNSKKEKDALEDKKRNPILKYIGKPKNSSQSTFHIPLSPVE
VKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLEGDSSRSEIRLGRSESLKGRE
EMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRS
IESPSLVFCTDALLPHPLEDDLGQLSDLEPELDAQNWQHTVGKDVVAGLSQREIDRKEVI
NELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKL
REEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQE
AESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTEGGTCEHEKLCRARDQCREILKY
VNEAVKQTENRHRLEGYQKRLDTTSLERASNLLAVEFKSLDLTTRRMIHEGPLTWRISKD
KTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAAGSSDSKQTFSPVLKLNAVLIRSVATD
KRAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGTAPPPVHPPPPGP
QGAAHQGPAPSRVGLDDSEAFPRRCSEPEPEELPGADIGPQQRIRGTHPVLPEDPEQEGT
GEEEKLGALPHPSSSLVGENTGIRTRDPIHLPLPGPLFMEGLAEAALEDVENLRHLILWR
LLPSHTTEPQATGEPEDDLTPTPSVISVTSHPWDPGSPGRAPAGGEGDNAQLPGLEGSRP
ELEDGAPCSLEHLPPRTRNSGIWELPELDRSPAEEVSSTEAAGTYKVVRKADVAGSKVVP
ALPESGQSEPEPPDVEGGAKAAGNCFYVSMPAGPLDSSTETSGAPTSPPQPDGLPTWQAE
PQPQLRGGNGDQRHSSRSPPSLGLRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGG
ESSGGTTPVGSFHTEAARWTDSSLSPPAKEPLVSDSRDSHELGPCPEDSSDTPLEDRVAA
AATTPGL
NT seq 4704 nt   +upstreamnt  +downstreamnt
atgagtgtaaggttaccccagagtatagacaggttaagtagcctgtcttctctgggagat
tcagcctctgagcgcaagtccccttcccaccaccacgaaccctctgacgcctctgagaca
acaggccttgttcagcgctgcgtcatcatccaaaaggaccaacatggctttggcttcaca
gtcagtggggatcgcattgttctggtgcagtccgtgcggcctggaggtgcagccatgaaa
gccggagtgaaagagggtgaccggatcatcaaagtgaatggcaccatggtcaccaatagc
tcacacctggaggtggtgaagcttatcaaatctggtgcctatgttgcactgactctcctg
ggctcttcaccctcgtctgttggtgtctccgggctccagcaggacccagccccagcagga
ggtccccgagtcacccctatgatcccaccaccaccacctcctccacctctaccacctcca
cagcgcatcacaggacccaaacctctacaggatcccgaatttcaaaaacatgccacccag
atccttaggaatatgctgaggcaggaggagaaagagctacagcgtatctgtgaggtgtat
aaccggaaccccgccagcctgctggaagagcagattgaaggcgcccggcggcgagtctct
cagttacagctgaagatccaacaggagactggtggcttagtggacgtacttccactgtat
ggtgataccagccagagatcatcagaaggccgcctttctctcgattcccaggaaggggac
agtggcttggactctgggacagaacgctttccttccctcagtgagtcattgatgaatcgg
aactcggtactgtcagaccccgggcttgacagtcctcgaacctcccctgtgatcatggcc
aggatggctcagcaccacaggcggcagggctcagatgcaccagtgcccccttccagcgac
cagggtgtggatcaaagcccaaagcctttaattatcggcccagaggaagattatgaccca
ggttatttcaacaacgagggcaacatcatattccaggatcttgagaagcttaagtcacgc
ccagctcacctgggggtttttctgcgttatatcctgtctcaggcagaccccagtccactg
cttttctacttgtgtgcagaagtttatcagcagacaaaccccaaagattcccgaagcttg
gggaaagacatctggaatattttcctagagaaaaatgcgcctctgcgagtgaagatccct
gaaatgttacaggctgaaattgacttgcgcctgcggaacagtgaggacatccgcagcgtc
ctctgtgaagcccaggaggcagccatgccagagatccaggagcagatccatgactacaga
acaaagcgtactctgggactgggcagcctgtatggtgaaaacgacctgctggacctggat
ggggaccctctacgagagcgccaggtggccgagaagcagctggctgcccttggagatatt
ttgtccaagtacgaggaagacaggagtgcccccatggactttgccctcaatacctacatg
agctatgctgggatccgccttcgagaggcacgaccttccaacccagctgaaaaggcccag
tctgctcctgacaaggacaaatggctacccttcttcccgaagaccaagaagcagagcagc
aattccaagaaagaaaaggatgccttggaggacaagaagcgaaaccccatcctcaaatac
attgggaagcccaaaaactcttcccagagcacatttcatattcccttgtcccctgtggaa
gtcaaaccagggaatgtaaggaacatcattcagcattttgagaacaaccagcagtatgac
gccccagagcctgggacgcagcggctctcaacaggaagctttcctgaggacctgctggag
ggtgacagttcccgctcagagatccgcctgggccgctctgagagcctaaagggccgagaa
gagatgaagcggtctcggaaggcggagaacgtgccccgctctcgcagtgacgttgacatg
gatgctgctgcggaggccactcgcctccaccagtcggcctcgtcctctgcctccagcctc
tccaccaggtctcttgaaaacccaacccctcccttcacccccaaaatgggccgcaggagc
attgagtcccccagcttggtgttctgcacagatgccctccttccccaccccctagaggat
gatctgggccagctgtctgacctggaaccagagctagatgcccagaactggcagcatact
gtgggcaaggatgtggtggctgggctaagccagagggagattgaccgaaaggaggtcata
aatgagctctttgtgaccgaagcatcccatctgcgcacactccgtgtcctggacctaatc
ttctaccagcggatgaagaaggagaacctgatgccccgggaggagctggcccggctcttt
cctaacctgcctgaactcatagagatccacaattcctggtgtgaagccatgaagaagctc
cgggaggagggccccatcatcaaagaaatcagtgacctcatgctggcacggtttgatggt
cctgcccgagaggaactccagcaggtggctgctcagttctgttcctatcagtcgatagcc
ctggagctgatcaagaccaagcagcgcaaggagagccgcttccagctcttcatgcaggag
gcggagagccacccccagtgccggcggctgcagcttagagacctcatcatttccgagatg
cagcggctgaccaagtacccactgctgctggaaaacatcatcaagcacaccgagggtggc
acctgtgagcacgagaagctctgccgggcccgggatcagtgccgggaaattcttaagtac
gtgaacgaagccgtaaagcagacagagaatcggcaccgtttggagggctaccagaaacgc
ctggataccacctccttggagagggccagcaaccttctggcagtagagttcaagagcctg
gatcttactaccagaaggatgatccatgaggggcccttgacctggaggatcagcaaggat
aagaccttggacctgcacgtgctactgttggaggacctcctggtgctgctgcagaagcag
gatgagaagctgctcctgaagtgtcacagcaagacagccgcgggctcgtcagacagcaag
cagaccttcagccccgtgctcaagctcaatgctgtgctcatccgctccgtggccacagat
aaacgggccttcttcatcatctgcacctccgagctaggcccaccccagatctatgagctg
gttgccttgacgtcatcagacaagaacacatggatggagctcttagaagaggccgtgcgg
aacgccacccggcaccccggaaccgccccgccacctgtccatcccccaccccccggcccc
cagggggcagcccaccagggcccggcacccagcagggtaggactggatgactccgaagca
ttcccaagaaggtgttctgagccagagcccgaggagctgcctggagcagacatcggtccc
cagcagaggatcagagggacacacccagtactgccagaggatcctgagcaggagggcact
ggagaggaggagaagctgggggcccttcctcacccctcctcatccctggttggagagaac
acgggcatcaggacaagggaccccatccacctgcccctcccaggccctctgttcatggaa
ggacttgccgaggcagccctggaagatgtggagaacctgaggcacctgatcctgtggcgc
ctgctgccgagtcacaccacagaaccacaggccaccggggagcctgaggatgacctgaca
cccaccccttctgtcatcagcgtcacctctcatccctgggacccaggctccccagggcgg
gcccccgctgggggtgaaggcgacaacgcccagctccctgggctagaagggagccggcca
gagctagaagacggggctccctgttctctggaacacttgcccccaagaaccagaaattct
gggatctgggagttgcccgagctggataggagtccagccgaagaggtttcaagcacagaa
gcagcaggaacttacaaagttgtgagaaaagccgacgtggcaggcagcaaggttgtccct
gcactaccagagagtggccagtcagagcctgagccacctgacgtggaaggcggagcaaag
gctgcggggaactgtttttatgtcagcatgccagcaggacccctggactccagcaccgag
acttcaggggcacccaccagccccccacagcctgacggcctccctacatggcaggcagag
cctcagccccagctgcggggaggcaacggagatcaaagacactccagccgctctcccccg
agcctgggcctccgggacgtgggcatgatctttcgaaccatcgagcagctcaccctcaag
ctcaacaggctcaaggacatggagctggcccacagagagctgctgaagtcccttggtgga
gagtcatctggtggcacaacacctgtgggcagtttccacacagaggcggcaagatggaca
gacagttccctctcacccccagccaaggagcccctggtctctgactccagggacagccat
gaactaggtccctgccctgaggacagttctgacactcccctggaagacagggtggcagcc
gcagccacaacaccaggactgtaa

KEGG   Loxodonta africana (African savanna elephant): 100674589
Entry
100674589         CDS       T04351                                 

Gene name
ARHGEF1
Definition
(RefSeq) rho guanine nucleotide exchange factor 1 isoform X2
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04611  Platelet activation
lav04810  Regulation of actin cytoskeleton
lav04928  Parathyroid hormone synthesis, secretion and action
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674589 (ARHGEF1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100674589 (ARHGEF1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100674589 (ARHGEF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100674589 (ARHGEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674589 (ARHGEF1)
   05205 Proteoglycans in cancer
    100674589 (ARHGEF1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100674589 (ARHGEF1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100674589 (ARHGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100674589 (ARHGEF1)
Membrane trafficking [BR:lav04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100674589 (ARHGEF1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3 Syntaxin_2
Other DBs
NCBI-GeneID: 100674589
NCBI-ProteinID: XP_010600810
LinkDB
Position
Unknown
AA seq 912 aa
MQAAEEMARGAAPGPPRPGLVPISIIGAEDEDFENELETNAEEQNSQFQSLEQVKRRPVH
LIALLQHVALQFEPAPLLCCLHADMLSTLGPKEFKKAFIDFYHSFLDKTAVLRVSVPANV
AFELDRTRPDLISEDIQRRFVQEVVQSQQAAISRQLEDFRSKRLMGMTPWEQELAHLEAW
AGRDRTTYEARERLTAERLLTHLEEMQPTISTDEEKSAAVVNAISVYMRHLGVRTKSGDK
KSGRNFFRKKNRRPDEPPKTKKGLSSILDAARWNRGEPQVPDFRHLKIEAEADKQGSTER
KGGLAVPSRDRNVGVPGQDTLGVSLHPLSGDSPDREPGVDPPLELGDLPLQGPTNLEPPA
APESTEEGADTESPEPGDEGEPGRLGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVI
SELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPQDELQNIFPSLDELIEVHSLFLDSLMKR
RQDSGYLIEEIGDVLLARFDGAEGTWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQ
DAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERKKVERAAECCREILHH
VNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKD
KAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD
HKAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPPRTSPSST
REPLLSSSENSNGGREMPPPDGRMERILSDLLPFCRPGPEGQLAATALQKVLSLKQLLLP
VKEDSGAGPPREGDGVPGGGPLSLSQTQKVQEKLLSLEETVKRLEEMEEEFCRLRLLLSQ
LGGNTAPQPGCT
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgcaggcagcggaagaaatggcccgaggggcggccccagggcccccccggcctggcctg
gtgcccatcagcatcatcggggctgaggacgaagattttgagaatgagctggagacgaat
gcagaggagcagaacagccagttccagagcctggagcaggtgaagcggcgcccagtccac
ctcatagccctcctgcagcacgtggccctgcagttcgagccagcacccctgctctgctgc
ctccacgcggacatgctgagcaccctgggccccaaggagttcaagaaggcctttattgac
ttctaccacagcttcctggataagacagcggttctgcgggtgtcagtgcctgccaacgtc
gcctttgaacttgaccgtacgcggcctgacctcatctctgaggacatccagcggcggttc
gtgcaggaggtggtgcagagccagcaggcggccatcagccggcagctggaggacttccgc
tctaagcggctcatgggcatgacgccctgggagcaggagctggcccatctggaggcctgg
gctggacgggaccgcaccacctatgaggcccgggagcggctcacggccgagcggctactg
acccaccttgaggagatgcaacccaccatctctaccgatgaagaaaagagtgctgctgtg
gtcaacgccatcagcgtgtacatgcgccaccttggggtgcgaaccaagagcggggacaag
aaatcgggaaggaacttcttccggaaaaagaaccggcggccagatgagcctcccaagacc
aagaaaggactgagcagcatcctggatgccgcccgctggaaccggggagagccccaggtg
ccagattttcgacacctcaaaatcgaggctgaagctgataagcaaggctctacagaacgg
aagggaggcctggcagtgccttctcgagaccgaaatgttggggttcctgggcaagacacc
ctcggagtttctctgcaccctctgtctggggacagcccagaccgagaaccaggtgttgac
cccccactggagctgggggacctgcccctgcagggcccaacaaacctggagcccccggca
gccccagagagcactgaggagggtgctgacacagagagccctgagcctggagatgagggg
gagccagggcggttgggactagagctggaaccagaggagccccctggctggcgggaactg
gtcccgccggacaccctgcacagcctgcccaagagccaggtgaagcggcaggaagtcatt
agcgagctgctggtgacggaggcggcacacgtgcgcatgcttcgggtgctgcatgacctc
ttctaccagcccatggcggagggtggcttcttcccgcaggatgagctgcagaacatcttt
cccagcctggacgagctcatcgaggtgcattccttattccttgatagcctgatgaagcgg
agacaggacagtggctacctcattgaggagattggggatgtgctgctggcccggtttgat
ggtgctgagggcacgtggttccagaaaatctcctcccgcttctgcagccggcagtctttt
gccttagagcagctcaaagccaaacagcgcaaggatcctcgattctgtgcctttgtgcag
gatgccgagagccgtccacggtgtcgccgcttacagctgaaggacatgatccccactgag
atgcagcgcctgaccaagtaccccctgctcctccaaagcatcggacagaatacagaagag
cctgcggaacggaagaaagtggagcgggcggccgagtgctgccgggaaattctgcaccac
gtcaaccaggccgtgcgcgacatggaggacctgctgaggctcaaggattatcagcggcgc
ctggacttgtcccaccttcgtcagagcagcgaccccatgctgagcgagttcaagaacctg
gacatcaccaagaaaaagttggttcatgagggcccgctgacatggcgagtgacgaaggac
aaggctgtggaggttcatgtgctactgctggatgacctgctgctgctgctgcagcgccag
gatgagcggctgctgctcaaatcgcacagccgcacgctgacgcccacaccagatggcaag
accatgctgcggcctgtgctgcggctcacctccgccatgacccgagaggtggccactgat
cacaaagccttctacgtcattttcacttgggaccaggaggcccagatatatgagctggtg
gcacagacagtgtctgagaggaagaactggtgtgccctcatcacggagaccgctggatcc
ctgaaagtccccgcccccgcctcccgcccaaaacccccccggaccagcccaagcagcact
cgagaacccctgctcagcagctctgaaaacagcaacggtggcagagagatgcctccacct
gatggccgtatggagagaatcctcagtgacctcctgcccttctgcagaccaggccctgag
ggccagctcgctgccaccgcccttcagaaagtgctgtccttgaagcagctcctgttgcct
gtgaaggaagacagcggggcagggcctccccgagaaggggatggggtcccgggtggtggt
cccctgagcctatcgcagacccagaaggtccaggagaagctgctcagtctggaggagacc
gtgaagcggctggaggagatggaggaggaattttgccgccttcgactcctcctatctcag
ctgggtgggaacactgctccccagcctggctgcacctga

KEGG   Loxodonta africana (African savanna elephant): 100677568
Entry
100677568         CDS       T04351                                 

Gene name
AKAP13
Definition
(RefSeq) LOW QUALITY PROTEIN: A-kinase anchor protein 13
  KO
K16529  A-kinase anchor protein 13
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100677568 (AKAP13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100677568 (AKAP13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100677568 (AKAP13)
Membrane trafficking [BR:lav04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100677568 (AKAP13)
SSDB
Motif
Pfam: PH_16 RhoGEF PH C1_1 Prok-RING_1 RII_binding_1 C1_2 Ad_cyc_g-alpha zf-ribbon_3
Other DBs
NCBI-GeneID: 100677568
NCBI-ProteinID: XP_023408816
LinkDB
Position
Unknown
AA seq 2820 aa
MKLNPQQAPLYGDCVVTVLLAEEDKVEDDVVFYLVFSGSTLHHCTSTRKISADTLETIAP
GHDCCETVKVLLCASKEGLPVFVVAEEDFHFIQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSGDVNSLDEKVALAFRHLKLPAEWNVLGTDQTLHDGGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHKFLTEENAGEPDSWSSLSYEIPYE
DCSVRHHRERDIYTLTSESESHHEPPFPGDTCTGHIFKLRNIQQQLMKTNLKQMDSLMPL
MVTAQDPSSLPSTPDIDGQFPPCASEPMDSLQPSFPPKDTGSTPCCQGSSAKGQIESSCD
LSSVVKEENTDCSCKEENQGMERKGEEVEPAPTVDSGTVSDQDSCLQSMPDCGKKDTKGF
PSCGNSNEETGTNPFGMTADQESLGSRDNVLQGDLAAEPGTAQHVSGGELAVISTTDVSV
PDTAGEMEHGLMNPDTTFQKNVLEVEKSTKEGVENFRINTAGASDVKVTSKPVDKTSVPN
CVSATSSLDGNEPAESLLAFSNGETSAEGTTETETSSRGYKEGADVPVDQNSLVIPAAAK
DKILDGSEPGTPSASICEAVSASDLTFPGPEKDLISNWKSETNSSHVQSQSSKSPICSTT
GDDKLCADSVGQQNTVTPSGELVAKHCDDIVAQPESIIAGQPITQGSPPVVLSEAPQANT
VISDRVQDTQEHVGLCPPEDTDKGGQGEDLNLDTALTNMHEAASHPQPLVPKAEKEVVPD
QAVTSDSTFSPASRPGSDSVTKDDALSPVPSQEKKGTAAPELHEATDGRDDPGGGSSDPS
EQPLEDSAAGLTTSLSATDLQPSMGNTSPVGLGGQHEGPCPPAAPEVLSIKGLGTGSSLL
SVSKASLATESVLTREGKNLVVPESSSAQGQDDKDKAVICAFIKEDTLSSGASQEEQRTP
PPGQEALGFREEPSSAACAEGNALQHSDSLGTPSAFLNAETEHNKKVAPRGSLLTEGGAA
QSLVPPGASLSVDSRQEALGPEQSSPPLLPGQDVGVKNTQTQGKTAACEVSRNVTLDVAL
VSAQQDTFGARRKDISHNTQDIPISKVLLSQEQNTILGLPGALPDQGVTDLQVATTLEVL
PLDWEKGKLEGVDHSCIVGNSRETQMDKEADQVLLQPIAKELPAETGLLTTENRAPPGMK
EARQAAALHKESSIPTLSSTVSAKAVDLPKGADLIEEAASRIVDAVIEHVKASGALITDK
EISHIPSPSPSESGPVAEQLENVSTEKMNAFLPGETPQMVSVCGEATVNVAVCFAGKEEP
EESVLPVQGPEPATEMPGTKAEDEVDFLSNSKESSVSEVVAIGHITAPMMKQSPKTQVIN
QESWCTIEPCPEAASLLAPKQSPECDENFLHVGLGRECASSQGGLNRQSGSDSDLFHSPS
DETESIVFSKPEEEQLVCDTTGSSSSTDDTASLDRHSSHGSDVSLPQISNLNKSKDPQSL
NGFYSHGMGAERRESESEPAGSGEMEEEEMDSITEVPANCSVLRGSMRSLSPFRRHSWGP
GKNAASDAEMNQRSSMRVLGDVVRRRPIHRRSMSWCPSGVQYSAALSADFTCRSFSLEGL
TGGAGVRNKPSSSLEANSANTKELRHPFTGEERGGSLVSLSEEDLESGQREHRMFEQQSH
RSKQQGFNYCTSAISSPLTKSISLMAISHPASDNSRLFHNTSANLAESITEENYDIPPQS
PSKKDFEGKSGTKVSRTFSYIKNKMSSSKKNKEKEKEKEKIKEKEKDYKEKDKDKKTLNG
HTFGSIPVVGPINCSQCMKPFTNRDAYTCANCGAFVHKGCRESLASCAKVKMKQPKGSLQ
AHDTSSLPTVIMRNKPSQPKERPRSAVLLADETTAAPVFANRRSQQSVSLSKSVSIQNIA
GVGNDESMSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLMGDFEIESKQL
EAESWSRIVDSKFLKQQKKDVIKRQEVIYELMQTELHHVRTLKIMSDVYSRGMMTDLLFE
QQMVEKLFPCLDELISIHSQFFQRILERKKESLVEKSEKNFLIRRMGDVLVNQFSGENAE
RLKKTYGKFCGQHTQSVNYFKDLYTKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRIT
KYPVLFQRMLQYTKDNEVEEEDLAQSLSLVKDVIGAVDSKVASYEKKVRLIEIYTKTDSK
SIMRMKSGQMFAKEDLKRKKLVRDGSVFLKNMAGRLKEVQAVLLTDILVFLQEKDQKYVF
ASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWIHIIQDT
MAALNRDEDEGIPSENEEEKKMLDTKARELKEQLQQKDQQILHLLEEKETIFRDMTECST
PLPEDCSPTHSSRILFRSNTEEAPKGGPLMKSAINEVEILQGLVSGSLGGTMGPAISSPI
EQEGMVGPVSLPRRAETFGGFDCHQMNASKGGEKEEEDGQDLRRTESDSGLKKGGNANLG
FMLKRNSEVIQSIVHLHEILSTLQGVVLQQDSYIEDQKLMLSERVLTRSSSRPSSLIEQE
KQRSLEKQRQDLANLQKQQAQHLEEKRRREREWEARERELQEREARLAQWEEKVQRGQQD
LENDLRELQQKKDTYQYDLERLRAAQKQLEREQEQMKRDTERLXQRQIERDISQVSCQHT
KVMRIPSFFPNPEESPLPSAPSIAKSGSLDSELSVSPKRNSLSRTHKDKAFHILSSASQT
SKVPEGPSQTAVSTSTSTRLFGLSKPKEKKEKKKKSKGSRSQPGDGPASEVPAEGEEIFC
NT seq 8463 nt   +upstreamnt  +downstreamnt
atgaaacttaatccacaacaagctccattatatggcgattgtgttgttacagtattgctt
gctgaagaggataaagttgaagatgatgtagttttttacttggtattttcgggttctacc
ctccatcactgtacaagcactcgaaagatcagtgccgatacgttggagaccattgctcct
ggtcatgactgctgtgagacagtgaaagtgctgctctgtgcttccaaagaggggcttccc
gtgttcgtggtggctgaagaagactttcatttcatccaggatgaagcatatgatgcagcc
cagttcctggcaaccagcgctggaaaccagcaggctctgaacttcacccgctttcttgac
cggtcaggacctccatctggggatgtgaattccctcgatgagaaggtagcactggcattc
agacacctgaagctgccagcagagtggaatgtattggggacagatcagactttgcatgat
ggtggcccacgggagactttgatgcattttgctgtgcgattgggactgctaaggttgaca
tggttcctgttgcagaagccaggtggccgtggagctcttagcatccacaaccaggaaggg
gcgacgcctgtgagcttggccttggagcgtggttaccacaaacttcacaagtttttaact
gaggagaatgctggagaaccagactcctggagcagtttgtcctatgaaataccctacgaa
gactgttctgtgaggcatcatcgagagcgggacatctatacgttaacctctgagtctgaa
tcacatcatgaacccccatttcctggagacacttgcactggacacatttttaaacttagg
aacatccaacagcagttgatgaaaacaaacctcaagcagatggacagtcttatgccctta
atggttacagcacaggatccctcaagtcttcccagcaccccagatatagatggccagttc
ccgccctgtgcatcagagcccatggacagcctgcaaccttcttttcctcctaaagataca
ggtagtactccatgctgccaagggagctctgccaaggggcagattgagagttcctgtgat
ttgtcaagtgtagttaaggaagagaacacagattgttcctgtaaggaagaaaatcaaggc
atggagagaaaaggggaagaggtggagccagcccccactgtggactctggaactgtgtct
gatcaagacagctgccttcagagcatgcctgactgtggcaaaaaggacacgaaaggcttt
ccctcctgtggaaacagcaatgaagaaacgggaacaaatccttttgggatgactgcagac
caagagtctctgggcagtagagacaacgtcctgcagggagatctggctgcagagccaggc
acagcccagcatgtctctggaggtgagctggccgttatttcaacaacagatgtcagtgtc
ccagatactgcaggggaaatggaacatggtctcatgaacccagataccactttccagaag
aatgtgctcgaagtagagaaaagtacaaaggaaggagtcgagaactttcgtatcaacaca
gctggagcctctgacgtaaaagtcaccagtaagcctgtggataaaaccagtgttccaaac
tgtgtctctgccaccagttccctggatggtaatgaacctgccgagtctttacttgccttt
agtaatggagaaacctctgccgaaggaactacagaaacggaaacttcaagtagaggttat
aaagagggtgctgatgttcccgtagatcagaactccctggtaattccagctgctgcaaaa
gacaagatactagatgggtcagaacctggcactccctcagcaagcatatgtgaggcagtg
tcagcctccgatttaacttttcccgggccagaaaaagatttaatatcaaactggaaatca
gaaactaattcatctcatgttcaaagtcagagcagcaagtcacccatctgttctacaact
ggagatgataaactttgtgctgattctgtaggtcaacagaacacagtgactcctagtggc
gagctggtggcaaaacattgtgatgacatagttgcccagcctgaaagcatcatagcaggg
cagcccatcacacaaggttcaccccccgtggtcctctctgaagccccacaggctaacaca
gtcatctctgaccgtgtacaggatacccaggaacatgtgggtctttgtcctcctgaagat
acagataaagggggccaaggagaagatttgaatctagatacagctttaactaacatgcac
gaagcagcttctcatccacagccacttgtccccaaagctgagaaagaagtggtgccagac
caggcagtgacatcagacagcactttttctccagcaagcaggccaggcagtgactcagta
accaaagatgacgcactttctcctgtcccctcccaggaaaaaaaaggaacggcagctcct
gaactacatgaggctacagatggcagagatgacccaggcggaggttcgagtgatcccagt
gagcagccactagaagacagtgcagccggccttaccacatccctttctgctacagatctc
cagcccagtatggggaataccagccctgtgggacttggcgggcagcacgaaggtccctgt
cccccagcagccccagaagttctgagtatcaagggattgggcactggttcttccctacta
agtgtgagtaaggcctctttggccactgagtcagttttgactagagaaggaaaaaatcta
gtggttccagaaagctcttcagctcagggacaagatgacaaggacaaagcagtgatttgc
gccttcatcaaggaagacactctttcttcaggagcctcacaggaagagcagagaacacca
cctcctggacaggaagcactgggattccgtgaagaacctagttcagctgcctgtgctgag
ggcaatgcacttcagcacagtgattcactgggcacaccctctgcctttcttaatgcagaa
actgagcataacaagaaagtggccccacgaggatcactgctgactgaaggtggggctgca
cagagcttggtgccaccaggagcaagtctgagtgtagattccaggcaggaagccttgggc
ccagagcagagcagcccacctctgttgccaggtcaggatgttggagtgaagaacactcaa
acccagggaaaaactgctgcttgtgaggtgagcagaaatgtgacattggatgttgccttg
gttagtgctcagcaagatacttttggggccagaaggaaggatatatcacacaacacccaa
gacatccctatttcaaaagtcttgttgagccaggagcaaaatacaatcttgggtttgcca
ggagctttaccagaccaaggtgtgactgacctacaggtagctacaaccctagaggtgcta
ccacttgactgggagaaagggaagcttgagggagtagaccatagctgtattgtgggcaac
tccagggagacacagatggacaaggaagcagaccaagtcctgctgcagcctattgccaag
gagctccctgcagagacagggctcttaaccactgaaaacagggccccacctggcatgaag
gaagccaggcaagctgcagccctgcacaaggaaagcagtattcccactctgtctagcact
gtgtctgccaaagctgtggacctgcctaagggagcagacttgatagaggaggctgcaagt
cggatagtggatgctgtcatagaacacgtcaaggcctcaggagcactgattactgacaag
gaaatcagtcacattccatcacccagtccttctgagtcaggtcctgtggctgaacaacta
gagaatgtttctactgagaaaatgaatgctttcctgccaggggagaccccacaaatggtc
agcgtttgtggagaagccactgtgaacgttgcagtatgttttgccggaaaggaagagcca
gaggaaagtgttctgcctgtccaaggacctgagccggcaacagaaatgccaggcacgaaa
gctgaagatgaagtggattttctgagtaattccaaagagagttcagtttctgaagtggtg
gccatagggcacataactgcacctatgatgaaacaaagcccgaagacccaggtgataaac
caagaaagctggtgtaccatagaaccatgccctgaagcagcatctcttttggctcccaag
cagagcccagaatgtgatgaaaacttcctccatgttggactgggcagagagtgtgcctcg
tcacaaggtggacttaacagacagtctgggagtgattctgacctctttcactcgcccagt
gatgaaacggaaagcatcgtcttctcaaagcccgaggaagagcagttagtatgtgatacc
actggatccagttcttccaccgatgacacagcttccctggatcgacattcttcccatggc
agtgatgtgtccctcccccagatttcaaatttgaacaagtccaaggatccacaaagcctt
aatggcttctacagccatgggatgggagctgagaggcgagagagtgagagtgagcctgct
ggttcaggtgaaatggaagaggaggagatggacagcatcactgaggtgcctgcaaactgc
tctgtcctgaggggctctatgcgctctctgtcccctttccggagacacagctggggtcct
gggaaaaatgcagccagcgatgcagaaatgaaccaacggagttcaatgcgagttcttggg
gatgttgtcaggagacgtcccattcataggagaagtatgagctggtgtccttctggtgtg
caatactctgctgccctgagtgctgactttacttgcagaagtttcagtctcgaaggcttg
acaggaggagctggtgtcagaaacaagccttcctcatctctagaagcaaactctgcaaac
accaaagagctcaggcatcccttcactggtgaggagcggggcggctctttggtgtcactt
tcagaagaggatctggagtcgggccagagagaacataggatgtttgagcagcagagtcac
agatctaaacaacagggatttaattactgtacctcagccatttcttctccactgacaaag
tccatctcattaatggcaatcagccatcctgcatcggacaattcacgactgttccacaac
accagcgctaatctggctgaaagtataacagaagagaactatgatatcccgccacaaagc
ccttccaagaaagattttgaaggaaagagtggaacaaaagtcagccgcacattcagctac
atcaagaataaaatgtccagcagtaagaagaacaaagaaaaggaaaaagagaaagagaaa
attaaggagaaagagaaagattataaagagaaggacaaggacaagaagactcttaatggc
cacaccttcggttccattcctgttgtgggtcccatcaactgtagccagtgtatgaagcct
ttcaccaacagagatgcctacacttgtgcaaattgtggcgcttttgtccacaaaggctgt
agagaaagtctggcctcctgtgcaaaagtcaaaatgaagcagcccaaagggagccttcag
gcacatgacacgtcatctctacccacagtcattatgagaaacaagccttcacagcccaag
gagcgccctcggtcagcagtcctcctggctgatgaaaccactgccgccccagtgtttgct
aacaggcggtcccagcagagtgtctcactttccaaaagtgtctccatacagaacatcgct
ggagttggcaatgatgagagcatgtcaaacacctggaaattcctgtctcattcaacagac
tcactaaataaaatcagcaaggtcaacgagtcgacagagtcactgactgatgagggagta
ggtacagacatgaatgaaggacaactaatgggagactttgagattgagtccaaacagcta
gaagcagagtcctggagtcgaatagtggacagcaagttcctgaaacagcaaaagaaagat
gtgatcaaacggcaagaagtgatttatgagttgatgcagacggagttacatcacgtccgc
acactcaagatcatgagcgatgtgtatagccgggggatgatgacggatctgctctttgag
cagcaaatggtggagaagctgttcccctgtttggatgagctcatcagtatccatagccag
ttcttccagaggatcctggagcggaagaaggagtctctggtggaaaaaagcgaaaagaac
tttctcatcaggagaatgggcgatgtgcttgtcaaccagttttcaggtgagaatgcagaa
cgcttaaagaagacatatggcaagttttgtgggcagcacacccagtctgtaaactacttc
aaagacctttataccaaggataagcgttttcaagcctttgtaaagaagaagatgagcagc
tcagtggtgagaaggcttggaatcccagagtgcattttgcttgtgacccagcgcatcacc
aagtacccagttctattccagagaatgttgcagtataccaaagacaatgaagtggaggag
gaagatttagcccagtccttgagtctggtgaaggatgtgattggagctgtagacagcaaa
gtggcaagttatgagaagaaagtgcgtctcattgaaatttatacgaagacagatagcaag
tcgatcatgaggatgaagagtggtcagatgtttgcgaaggaggatttgaaacggaagaag
cttgtgcgggacgggagtgtatttctgaagaacatggctggaaggttgaaagaggttcaa
gcagttctgctcactgatattttagttttccttcaagaaaaagaccagaagtacgtcttt
gcgtcattggaccagaaatcaacagtgatctctttaaagaagctgattgtaagagaagtg
gcccatgaggagaaaggcttattcctgattagtatggggatgaaagaccccgagatggtc
gaagtccacgccagctccaaggaggagcggaacagctggattcacatcatccaggacacg
atggccgccctgaacagagatgaagacgaaggaatccctagtgagaatgaggaggaaaag
aaaatgttggacaccaaagcccgggaattaaaagaacaacttcagcaaaaggaccagcag
atcctacacttactggaagagaaggagacaattttccgggacatgacagagtgcagcacc
ccgttgccagaggattgctccccaacacacagctctaggatcctcttccggtccaacaca
gaagaggctcccaaaggaggacctttaatgaaaagtgcaatcaatgaggtggagatcctt
cagggtttggtgagcggaagcctgggaggaacaatggggccagcaatcagcagcccaatt
gagcaagaaggcatggtcggccctgtttccttgccccggagagcagagacctttggagga
tttgactgccatcagatgaatgcttccaaaggaggagagaaggaagaagaagatggccaa
gatcttaggaggacagaatcggatagtggcctgaagaagggtggtaacgctaacctgggc
tttatgcttaaaagaaacagtgaggtcatccagagcattgttcacctccacgaaattctg
agcactttgcagggtgtggtgttgcagcaggacagctacatcgaggaccagaagctgatg
ctgagtgagcgcgtgctcacacggagctcctcccgccccagctccctcattgagcaggag
aagcagcgcagcctggagaagcagcggcaggatctggccaacctgcagaagcagcaggcc
cagcacctagaggagaaacgcaggcgcgagcgggagtgggaagcccgtgagagggagctg
caggagcgcgaggcccggctggcccagtgggaggagaaggtgcagcgtgggcagcaggat
ttagagaacgacctcagggagctccagcagaagaaggacacataccagtatgacctggag
aggctgcgtgcggcccagaaacagctcgagagagagcaggagcaaatgaagagagacacg
gagcgcctcnaccaaaggcagatagaacgggacatctctcaggtctcatgtcagcatacc
aaggtgatgaggatcccgtccttcttccccaatcctgaggagtcccctctgccttctgca
ccttcaatagccaaatcagggtcactggactccgaactttcagtgtccccaaaaaggaac
agcctctctcggacacacaaagataaagcttttcacatactgagttcagccagccagaca
agtaaagtacccgaggggccaagccagactgcagtgtccacctccacctccacccgcctg
tttgggttatctaagccaaaggagaagaaggaaaagaagaagaagagcaaagggagccgt
tctcagcctggtgatggccctgcatctgaagtaccagcagagggtgaagagatcttctgc
tga

DBGET integrated database retrieval system