KEGG   Loxodonta africana (African savanna elephant): 100673560
Entry
100673560         CDS       T04351                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04071  Sphingolipid signaling pathway
lav04115  p53 signaling pathway
lav04141  Protein processing in endoplasmic reticulum
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04722  Neurotrophin signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100673560 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100673560 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100673560 (BAX)
   04215 Apoptosis - multiple species
    100673560 (BAX)
   04217 Necroptosis
    100673560 (BAX)
   04115 p53 signaling pathway
    100673560 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100673560 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100673560 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673560 (BAX)
   05202 Transcriptional misregulation in cancer
    100673560 (BAX)
   05203 Viral carcinogenesis
    100673560 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100673560 (BAX)
   05212 Pancreatic cancer
    100673560 (BAX)
   05225 Hepatocellular carcinoma
    100673560 (BAX)
   05226 Gastric cancer
    100673560 (BAX)
   05214 Glioma
    100673560 (BAX)
   05216 Thyroid cancer
    100673560 (BAX)
   05220 Chronic myeloid leukemia
    100673560 (BAX)
   05217 Basal cell carcinoma
    100673560 (BAX)
   05218 Melanoma
    100673560 (BAX)
   05213 Endometrial cancer
    100673560 (BAX)
   05224 Breast cancer
    100673560 (BAX)
   05222 Small cell lung cancer
    100673560 (BAX)
   05223 Non-small cell lung cancer
    100673560 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100673560 (BAX)
   05014 Amyotrophic lateral sclerosis
    100673560 (BAX)
   05016 Huntington disease
    100673560 (BAX)
   05020 Prion disease
    100673560 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100673560 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100673560 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100673560 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673560 (BAX)
   05152 Tuberculosis
    100673560 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100673560 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100673560 (BAX)
   05161 Hepatitis B
    100673560 (BAX)
   05160 Hepatitis C
    100673560 (BAX)
   05164 Influenza A
    100673560 (BAX)
   05162 Measles
    100673560 (BAX)
   05168 Herpes simplex virus 1 infection
    100673560 (BAX)
   05163 Human cytomegalovirus infection
    100673560 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673560 (BAX)
   05169 Epstein-Barr virus infection
    100673560 (BAX)
   05165 Human papillomavirus infection
    100673560 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100673560 (BAX)
   01524 Platinum drug resistance
    100673560 (BAX)
   01522 Endocrine resistance
    100673560 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100673560 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100673560 (BAX)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100673560 (BAX)
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   100673560 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100673560
NCBI-ProteinID: XP_010584819
LinkDB
Position
Unknown
AA seq 224 aa
MDGSGEQPRGGGPTNSEHIMKTGALLLQGFIQDRAKQMGGETPELALERVPQDPSTKKLS
ECLKRIGDELDSNLELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKVGGCRTVFLSDLGEPGHHEVNPCSSLYKYKAPEVGKSLVGMKKQKKVREGQKSSRKW
NEIRLLSLSQDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
NT seq 675 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccaactctgagcacatcatg
aagacgggggcccttttgcttcagggtttcatccaggatcgagcaaagcagatgggaggg
gagacgcctgagctggccctggagcgggtgccccaggatccatccacgaagaagctgagc
gagtgtctcaagcgcatcggggacgaattggacagtaacttagagctgcagaggatgatt
gcagctgtggacacagactctccccgtgaagtctttttccgagtggcagcagagatgttt
tccgatggcaacttcaactggggccgggttgttgcccttttctactttgccagcaaactg
gtgctcaaggtgggcggatgtagaacagtgttcctgtcagacctgggagaacctgggcat
cacgaggtcaacccctgtagcagcctctacaagtacaaagcccctgaggtagggaagagt
ttggtgggaatgaagaaacagaagaaggtcagggagggacagaaaagcagcagaaagtgg
aatgagatcagactgctgtccttgtcccaggatggcctcctctcctactttgggaccccc
acgtggcagacagtgaccatcttcgtggctggcgtgctcactgcctcactcaccatctgg
aagaaaatgggctga

DBGET integrated database retrieval system