KEGG   Loxodonta africana (African savanna elephant): 100673604
Entry
100673604         CDS       T04351                                 

Gene name
CSNK1D
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04340  Hedgehog signaling pathway
lav04390  Hippo signaling pathway
lav04540  Gap junction
lav04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100673604 (CSNK1D)
   04390 Hippo signaling pathway
    100673604 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100673604 (CSNK1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100673604 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100673604 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100673604 (CSNK1D)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100673604 (CSNK1D)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100673604 (CSNK1D)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100673604 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 100673604
NCBI-ProteinID: XP_010595172
LinkDB
Position
Unknown
AA seq 421 aa
MGLTAASHTRGENVKTTGMRLEVGHPVAVFLGTDIAAGEEVAIKLECVKTKHPQLHIESK
IYKMMQGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMIS
RIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLT
GTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMS
TPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK
FGASRATDDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTAN
TSPRPVSGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSAVH
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggggctcacggctgcgtctcacacacgtggggaaaatgtcaaaacaactggaatgcgg
ttggaggtgggacatcctgtggctgtgttcctaggtacggacattgctgcaggagaagaa
gttgccatcaagcttgaatgtgtcaaaaccaaacaccctcagctgcacatcgagagcaag
atctacaaaatgatgcagggaggagtgggaatccccaccattcgatggtgcggggcagag
ggggactacaacgtcatggtgatggagctgttgggaccaagcctggaagacctcttcaac
ttctgctcaaggaaattcagtctcaaaactgtcctactcctcgctgaccaaatgattagt
cgtattgagtacattcattcaaagaacttcatccaccgagatgtgaagccagataacttt
ctcatgggactgggcaagaagggcaacctggtctacatcatagactttgggctggccaag
aagtaccgggacgccaggactcaccagcacatcccctaccgtgagaacaagaaccttacc
gggactgctcgatatgcctccatcaacacccatcttggaatcgaacaatctcgacgagat
gacttggagtccctgggctatgtgttaatgtacttcaacctgggctctctcccctggcag
gggctgaaggctgctaccaagagacagaaatacgaaaggattagtgagaagaaaatgtcc
actcccattgaggtgttgtgtaaaggctacccttctgagtttgccacatacctgaatttc
tgccgctcgttgcgttttgatgataagcctgactactcgtacctgagacaactcttccgg
aacctgtttcatcgccagggtttctcctacgactatgtgtttgactggaacatgctcaag
tttggtgccagccgggccactgatgatgctgagcgggaacgccgggaccgagaggagcgg
ctgagacactctcggaatccagctacccggggcctcccttccacggcctcaggccgcctg
agggggacacaggaagtggctccccccacgcccctcacgcctacctcacacactgcaaac
acctctccgcggcctgtctctggcatggaaagagagcggaaagtgagtatgcggctgcac
cgcggcgccccggtcaacgtgtcctcatctgatctcacaggccggcaagatacctcgcgc
atgtccacctcacagattcccggtcgggtggcgtccagtggtcttcagtctgccgtgcac
cggtga

DBGET integrated database retrieval system