KEGG   Loxodonta africana (African savanna elephant): 100673667
Entry
100673667         CDS       T04351                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X6
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04066  HIF-1 signaling pathway
lav04934  Cushing syndrome
lav05200  Pathways in cancer
lav05204  Chemical carcinogenesis
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100673667 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673667 (ARNT)
   05204 Chemical carcinogenesis
    100673667 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100673667 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100673667 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100673667 (ARNT)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100673667 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS HAUS2
Other DBs
NCBI-GeneID: 100673667
NCBI-ProteinID: XP_003409533
LinkDB
Position
Unknown
AA seq 789 aa
MAATAANPEMTSDVPSLGPAIASGNSGPGIQGGGVIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENTLTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSMNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTSVKNSSQEPRPTLPSTIQ
RPQLGPTANLPLEMGSGPLAPRQQQQTELEVVPGRDGLASYSHPQVSVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYSSISADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPSVTIVQPSGSAGQMLAQISRHSNPTQGAAPTWTPSTRPGFSAQQVTSQATAKT
RSPQFAVGNFQTPSSFSPMSLPGAPTTSPGAAAYPSLTNHGSSFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPSAQQPGQPEVFQEMLSMLGDQNNSYNNEEFPD
LTMFPSFSE
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggcggcgactgctgctaaccccgaaatgacatcagatgtaccgtcactgggaccagcc
attgcctctggaaactctgggcctgggattcaaggcggaggggttattgtccagagggct
attaagcggcgaccagggctagattttgatgatgatggagaaggcaacagtaaattcttg
aggtgtgatgatgaccagatgtctaatgataaggagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagactcgccagggaaaatcatagtgaaattgaacggcgg
cgacgaaacaagatgacagcctacatcacagaactgtcggacatggtgcccacctgtagt
gccctggctcgaaaacctgacaagctaaccatcttacgcatggcagtttctcatatgaag
tccttgcggggaactggcaacacatccactgatggcacctacaagccatctttcctcact
gatcaggaactaaaacatttgatcttggaggcagcagatggctttctgtttattgtctca
tgtgagacaggccgagtggtatatgtctctgactctgtgacccctgttctgaaccagcca
cagtctgaatggtttggcagcacactctatgatcaggtgcacccagatgatgtggacaaa
cttcgtgagcagctttccacttctgaaaataccctgacagggcgtatcctagatctgaag
actggaacagtgaaaaaggagggtcagcagtcttccatgagaatgtgtatgggctccagg
agatcatttatttgccgtatgaggtgcggcagtagctccgtggacccagtctccatgaat
agactgagctttgtgaggaacaggtgcaggaatgggcttggctctgtgaaggatggagaa
cctcacttcgtggtggtccactgcacaggctacatcaaggcctggcccccagcaggtgtc
tctctcccagatgatgacccagaggctggccaggggagcaagttttgcctagtggccatt
ggcagactgcaggtaacaagttctcccaactgtacagacatgagtaacatttgtcaacca
acagagtttatctcccgacacaacattgaaggaatcttcacttttgtggatcaccgctgt
gtggctactgttggctaccagccacaggagctcttaggaaagaatattgtggaattctgt
catcctgaagaccaacagcttctaagagacagtttccaacaggtggtgaagttaaaaggc
caggtgctgtctgtcatgttccggttccgatctaagaaccgagaatggctctggatgaga
accagctcctttactttccagaacccttactcagatgaaattgagtacatcatatgtacc
aacaccagtgtgaagaactctagccaggaaccacggcctacacttcccagcacaatccag
aggccacagctaggtcccacagctaatttacccctggagatgggctcagggccgctggca
cccaggcagcaacaacaaacagaactggaagtggtcccaggaagagatggactagccagc
tacagtcatccccaggtctctgttcagcctgtgacaaccacaggaccagaacacagcaag
ccccttgagaagtcagatggtctgtttgcccaggatagggatccaagattttcagaaatc
tactccagcatcagtgcagatcagagtaaaggcatctcctccagcactgtccctgccacc
caacagctattctcccagggcaacacattccctcctaccccccggccggcagagaatttc
aggaatagtggtctggccccttctgtaaccattgtccagccatcaggttctgcagggcaa
atgttggcccagatttcacgccactccaaccccacccagggagcagccccaacttggacc
cccagtacgcgcccaggcttctctgcccagcaggtgacttcccaggctacagccaagacc
cgttctccccaatttgctgtgggcaactttcagactccatcctccttcagccccatgtcc
ctccctggtgctcctactacatcacctggtgctgctgcctatcctagtctcacgaaccat
ggatccagcttcgctcctgagactggacagactgctggacaattccagacacgaacagca
gagggtgtgggtgtctggccgcagtggcagggccagcagcctcatcatcgttcgagttct
agtgagcaacatgttcagcagccatcagcacagcaacccggccagcctgaggtcttccag
gagatgctgtccatgctgggagaccagaacaacagctacaacaatgaagaatttcctgat
ttaactatgtttccctccttttcagaatag

DBGET integrated database retrieval system