KEGG   Loxodonta africana (African savanna elephant): 100673871
Entry
100673871         CDS       T04351                                 

Gene name
GLUL
Definition
(RefSeq) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00220  Arginine biosynthesis
lav00250  Alanine, aspartate and glutamate metabolism
lav00630  Glyoxylate and dicarboxylate metabolism
lav00910  Nitrogen metabolism
lav01100  Metabolic pathways
lav01230  Biosynthesis of amino acids
lav04217  Necroptosis
lav04724  Glutamatergic synapse
lav04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100673871 (GLUL)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    100673871 (GLUL)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100673871 (GLUL)
   00220 Arginine biosynthesis
    100673871 (GLUL)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100673871 (GLUL)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100673871 (GLUL)
   04727 GABAergic synapse
    100673871 (GLUL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100673871 (GLUL)
Enzymes [BR:lav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     100673871 (GLUL)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100673871 (GLUL)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-GeneID: 100673871
NCBI-ProteinID: XP_003410905
UniProt: G3SM75
LinkDB
Position
Unknown
AA seq 373 aa
MATSASSHLNKGIKQVYMALPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTFQSEGSNSDMYLIPAAMFRDPFRKDPNKLVFCEVYKYNRKPAETNLRHTCKRI
MDMVSNHHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEESIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
LNETGDEPFQYKN
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggccacctcagcaagttcccacttgaacaaaggcatcaagcaggtatacatggctctg
cctcagggcgagaaagtgcaagccatgtatatctggatcgatggcactggagaaggacta
cgctgcaagacccgtaccctggacagtgagcccaagtgtgtagaagagttgcccgagtgg
aattttgatggctccagtacgttccagtctgaagggtccaacagtgacatgtatctcatc
cctgctgccatgtttcgggaccctttccgcaaggaccccaacaagctcgtgttctgtgaa
gtctataagtacaaccgaaagcctgcagagaccaatttaaggcacacctgtaaacgaata
atggacatggtgagcaaccatcacccctggtttggaatggagcaggaatacaccctcatg
ggaacagatgggcacccctttggttggccttccaacggcttccctgggccccaaggtcca
tattactgtggcgtgggagcagacagagcctacggcagggatattgtggaagctcactac
cgggcctgcttgtatgccggcatcaagattggggggacgaatgccgaggtcatgcctgcc
cagtgggagttccagataggaccctgtgaaggaattgacatgggggatcatctctgggtg
gcccgtttcatcctgcaccgtgtatgtgaggactttggagtgatagcaacctttgatcct
aagcctatccctggaaactggaatggtgcaggctgccataccaactttagcaccaaggcc
atgcgagaagagaatggtttgaagtacattgaagagtctatcgagaaactaagcaagcgg
caccagtaccacatccgcgcttacgatcccaaagggggcctggacaatgcccggcgcttg
actggattccatgaaacctccaacatcaacgacttttctgccggtgtggccaaccgtggc
gccagcatccgcattccccggactgtcggccaggagaagaagggttactttgaagaccgc
cgcccctctgccaactgtgaccccttctcggtgacagaagccctcatccgcacgtgtctt
ctcaacgagaccggcgatgagcccttccagtataaaaactaa

DBGET integrated database retrieval system