KEGG   Loxodonta africana (African savanna elephant): 100673917
Entry
100673917         CDS       T04351                                 

Gene name
SCRIB
Definition
(RefSeq) LOW QUALITY PROTEIN: protein scribble homolog
  KO
K16175  protein scribble
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100673917 (SCRIB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100673917 (SCRIB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100673917 (SCRIB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100673917 (SCRIB)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 LRR_8 LRR_4
Other DBs
NCBI-GeneID: 100673917
NCBI-ProteinID: XP_023397380
LinkDB
Position
Unknown
AA seq 1405 aa
MLKCIPLXRCNRHVESVDRRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPKLRELWLDRNQLSALPPSESSGTCGASLTDPQSMGHSLQIQLG
QLWQITNTPAQHGRPPKKPFELMQEQGLLGGIGWSVLPQKPSVLLGACHGMEPPGEPLSP
AWRCSVGLSGNHLECPTSQRSRGPGEGGAGGVLGGRPPHAHPQPTVHFAEDTLLPQMNSE
DEEGQLEAPWPLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGMRPDGEGQAAPG
SWHNGPHAPWASQAEEEEEPEEEAQEEAAASAPSVKGVSFDQANNLLIEPARIEEEELTL
TIVRQTGGLGISIAGGKGSSPYKGDDEGVFISRVSEEGPAARAGVRVGDKLLEVNGVALQ
SAEHHEAVEALRGAGATVRMRVWRERMVEPENAVTVTPLRPEDDYSPRERRGGSLRLPLP
LPQPEASGPLRQRHAACLLRSEKGLGFSIAGGKGSTPYRAGDAGIFISRIAEGGAAHRAG
TLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTIALLLEREAGAPLSPSPPPHSPPPPA
AASIPTTATAGEAGPPRLSPSLLATALEGPYPVEEIRLPRAGGPLGLSIVGGSDHSSHPF
GVQEPGVFISKVLPRGLAARNGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELHLLV
RRDPPPPGMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGVFISKVSPTGAAGRDG
RLRVGLRLLEVNQQSLLGLTHSEAVQLLRSVGDTLTVLVCDGFDTSTATALEVSPGVIAN
PFVAGIGRRNSLESVSSIDRELSPEGPGKDKELARQTPPRELEATEATGRSPEPLKLDYR
ALAAVPSGGSVQRVPSGVTGTWTDEAPCFPGSQQPPSPPSPDELPANVKQAYRTFAAVPI
THPPDDASAQPSTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQ
EEEARKLQQKRAQVLREEAATTGEPETGVALDGEALDGQEEEPPWAGPGPAEGLSSASPP
SLGGSAPVRTAKAERRHQERLRVQSPELPIPERALSPAERRALEAEKRALWRAARMKSLE
QDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDLGLQTSSSPGRLLLSGK
KFDYRVFAALPSSRPVYEIQSPGFAEELRSLEKSPSPGPQEEDGEVALVLLGRPSSGASG
PEEVTLCSSRRPLRPGRRGLGPVPS
NT seq 4218 nt   +upstreamnt  +downstreamnt
atgctcaagtgcatcccgctgntgcgctgcaaccggcacgtggagtcggtggaccggcgg
cactgctcgctgcaggccgtgcccgaggagatctaccgctacagccgcagcctggaggag
ctgctcctggacgccaaccagctgcgcgagctgcccaagccatttttccgcctgctaaac
ctgcgtaaactgggcctcagtgacaacgagatccagcgcctgcctcctgaggtggccaac
ttcatgcagttggtggagctggacgtgtctcggaacgacatccccgaaatccccgaaagc
ataaagttttgtaaggccttggagattgctgatttcagcgggaatcctctgtccaggctc
cctgacggcttcactcagctgcgcagcctggctcacctggccctgaatgacgtgtccctg
caggcactgccaggggacgtgggcaacctcgccaatctggtcaccttggaactccgggag
aacctgctcaagtccttgcctgcgtccctgtccttcctggtcaagctggaacagctggat
cttggaggcaacgacctggaagtgctgcctgacaccctgggggctttgcccaaacttcga
gaactgtggctggaccggaatcagctgtcagcactgccccccagtgagagctcggggacc
tgcggcgcctcgttgaccgatccccagagcatgggccattcgcttcaaatacaacttggc
caactttggcagatcacaaacacgccggcgcaacatggccggcccccaaagaagcctttt
gaattaatgcaggagcagggcctgctgggagggatcgggtggtctgtcctccctcaaaag
ccatctgtactactcggggcttgtcatggcatggaaccccccggggaacctctgtctcct
gcctggcgctgctctgtggggctttccgggaaccacctagaatgcccgacctcacagcgc
tcccgtggccctggagaaggtggggctgggggcgtgctgggtggtcgtcctcctcacgca
cacccacagcctacagtgcacttcgcagaggacacactgttgccacagatgaacagtgag
gacgaggaggggcagctcgaggccccctggcccctcccgggcgggcggcaacggctgatc
cgcaaggacacgccacactacaagaagcacttcaagatctccaagctgccgcagccggag
gcagttgtggccctgctgcaggggatgcggccagacggggagggccaggctgcgcctggc
agctggcacaacggcccccacgcgccctgggcttctcaggctgaggaggaagaggagcct
gaggaagaggcccaggaggaggccgcagcctccgcaccgtccgtcaagggggtgtcgttt
gaccaggccaataacctgctgatagagcctgcccgcattgaggaagaggagctgacgctc
accattgtgcgacagacggggggcctgggcatcagcattgcagggggcaagggctccagt
ccctacaagggagatgacgagggtgtattcatctcccgcgtgtcagaggagggccccgcg
gcccgggccggagtccgggtgggggacaagctcctggaggtgaatggcgtggccctgcag
agcgcagagcaccatgaggccgtggaggctctgcggggggcaggggccactgtgcggatg
cgggtgtggcgggagcggatggtggagcccgagaacgccgtcacggtcacgcctctgcga
cccgaggatgactacagcccgcgggagaggcgagggggcagcctgcgcttgcccctgccc
ctgccccagcctgaggcctcggggcccctgcgccagcgccacgctgcttgccttctgcgc
agcgagaaggggctgggcttcagcattgccggtgggaaaggctccactccctaccgggcc
ggcgatgcgggcatcttcatttcccgcattgcagagggtggcgctgcccaccgggcaggc
accctgcaggttggcgaccgcgtcctctcgatcaatggcgtggacatgacagaggcccgg
cacgaccacgctgtgtccctgctcactgcagcctcacccaccatcgctctgctgctggag
cgggaggctggggctcccctgtcccccagccctcccccacactccccaccaccccctgct
gctgcctccatcccaaccactgccactgctggggaggctgggccaccaagactgtccccc
agcctgctagccactgccctggaggggccctatccagtggaggagatccggctgcccaga
gcagggggcccactggggctcagcatcgttgggggttctgatcattcgagccacccgttt
ggcgtccaggagccgggtgtgttcatttccaaggtgctcccaagaggtctggctgcgcgc
aatggcctgcgggtcggggaccgcatcctggcggtgaacggccaggatgtgcgggaagcc
acacaccaggaagcggtcagcgccctgctccggccctgcctcgagttgcacttgctcgtg
cgcagggacccaccgcccccaggcatgagggagctctgcatccagaaggcccctggggag
aagctggggatcagcatccgtgggggtgccaagggccacgcggggaacccctgtgacccc
actgatgagggcgttttcatctccaaggtgagccccacgggggcagcaggccgggacggc
cggctgcgggtggggctgcgactgctggaggtaaaccagcagagcctgctgggcctgacg
cactccgaggccgtgcagctgctgcgtagcgtgggcgacaccctcaccgtgctcgtctgc
gacggcttcgacaccagcaccgccactgctttggaggtgtccccaggtgtcatcgccaac
ccttttgtggcaggcatcggccgccggaacagccttgagagtgtctcctccattgaccgt
gagctgagccccgagggccctggcaaggacaaggagctggccagacagaccccaccacgg
gagctggaggccacagaggccacgggccggagcccagagccgctgaagctggactaccgt
gccctggccgcagtgcccagcggtggcagcgtgcagagggtgccatcaggggtcactgga
acttggaccgatgaggccccctgctttcctggcagccagcagccgccatccccgccctcc
ccagacgagctgccggccaacgtgaagcaagcctaccggaccttcgccgccgtgcccatc
acgcacccccctgatgatgcctcagcccagccctccacacccgggcccgcggcctccccg
gagcagctgtcctttcgcgagcggcagaagtacttcgagctggaggtgcgggtgccccag
gcagagggcccgcccaagcgcgtgtccctggtgggcgccgatgacctgcgcaagatgcag
gaggaggaggcccgcaagctgcagcagaagagggcgcaggtgctgcgcgaggaggccgcc
actaccggggagccggaaacaggggtcgccctggacggggaggccctggacgggcaggag
gaggagccgccctgggccggcccgggccctgcagaagggctcagctcagcgtcccctcca
tccctgggaggcagcgcccctgtgcggacagccaaggctgagcggcgccatcaggagcgg
ctgcgggtgcagagcccggaactgcctatacctgagcgggccctgtcccccgccgagcgc
cgggccctggaggcagagaagcgcgcgctgtggagggcggccagaatgaagtctctggag
caggatgctctccgtgcacagatggttctcagcaagtcccaagagggccggggcaagcgt
gggcccctggagcggctggctgaagctccctcgcctgcacccaccccctcacccaccccc
ttggaagacctcggccttcagaccagcagctcccctggacggctgctcttgtctggaaag
aagtttgactacagggtgtttgcagccctcccttcttccagacctgtctatgaaatccag
tccccgggttttgctgaggagctgaggtctctggaaaagtctccgagccccggtccacag
gaggaggacggagaggtggccctggtgcttctgggcagaccctcgtccggtgcctccggc
cctgaggaggtgaccctttgcagtagccgccgccccttgcggccgggacgccgcggcctg
ggccccgtgccttcctag

DBGET integrated database retrieval system