KEGG   Loxodonta africana (African savanna elephant): 100673971
Entry
100673971         CDS       T04351                                 

Gene name
NRG4
Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform
  KO
K05458  neuregulin 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100673971 (NRG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100673971 (NRG4)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100673971 (NRG4)
SSDB
Motif
Pfam: EGF EGF_2 CD34_antigen
Other DBs
NCBI-GeneID: 100673971
NCBI-ProteinID: XP_010592079
LinkDB
Position
Unknown
AA seq 115 aa
MPTDHEEPCGLNHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKSD
LSVIFVVLAVLGTLIIGAFYFLCRKSHLQRASSAPYDISLVETSNTSAQDNHGEQ
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccaacagatcacgaagaaccctgtggtctcaatcacagatcattttgcctgaatggg
ggaatttgttatgtgatacctactattcccagcccgttttgtagatgcattgaaaactat
acaggagctcgttgtgaagaggtttttctcccaagttccagcatccaaactaaaagtgac
ctgtctgtgatttttgtggtattggctgtcctaggaacacttatcatcggagccttctac
ttcctttgcaggaagagccaccttcagagggccagttcagccccgtatgatatcagcctg
gtagagacaagcaacaccagtgcccaagacaatcatggagaacagtga

DBGET integrated database retrieval system