KEGG   Loxodonta africana (African savanna elephant): 100674030
Entry
100674030         CDS       T04351                                 

Gene name
RALBP1
Definition
(RefSeq) ralA-binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100674030 (RALBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674030 (RALBP1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100674030 (RALBP1)
Membrane trafficking [BR:lav04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100674030 (RALBP1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 100674030
NCBI-ProteinID: XP_003406838
LinkDB
Position
Unknown
AA seq 655 aa
MTECFLPPTSSPSEHRRGEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPADV
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPVPEPEVPQ
VDVPSLRPVFGIPLADAAERTMVCDGIRLPAVFRECLDYVEKHGMKSEGIYRVSGIKSKV
DELKAAYDREESPNLDEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRGTESEKV
QEFQRLLKELPECNYLLISWLIVHMDHVISKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVVLKQVTKPLRWSNMATMPTLPDTQESIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHVEREAIIELRVQLRLLQLQRAQ
SEQQVQDEEEPERRGGGAQPPRDSVLETKATKEQPKAVKEQGKPSPSKDRKETPI
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcctgccgcccaccagcagccccagtgaacaccgcagaggggaacac
ggcagtggtcttactcgaacccccagctctgaagagatcagccccactaagtttccggga
ttgtaccggacgggtgagccctcgcctccccacgacagcctccatgaacctgctgatgtt
gtgtctgatgatgagaaagaccatgggaagaaaaaaggaaaatttaagaaaaaggaaaaa
aggactgaaggctatgctgcctttcaggaagatagctctggagatgaagctgaaagtcct
tccaaaatgaagaggtccaagggaatccatgtttttaagaagcccagcttttctaaaaag
aaggagaaggattttaaaataaaagagaaacccaaagaagaaaaacataaagaagaaaaa
cacaaagaagaaaaacataaagagaagaagtcaaaagacttgacagcagccgatgttgtt
aaacagtggaaggaaaagaagaagaagaagaaaccagtgccggagccagaggtgcctcaa
gttgacgttccaagtctcaggcccgtctttgggattcctttggctgacgcggcggagcgg
accatggtgtgtgatggcatccgcctgccggccgtgttccgggagtgtttggattacgtg
gaaaagcacggcatgaagagtgaaggaatctacagagtttcaggaattaaatcaaaggtg
gatgagctaaaagcagcctatgaccgagaagagtctccaaacttggacgaatatgagcct
aacactgtagctagtttgctgaagcagtacttacgagaccttccagagaatttgcttacc
aaagagctgatgccccgattcgaagaggcttgtgggaggggcactgagagcgagaaagtg
caggaattccagcgtttactgaaggaactgccggaatgtaactatcttctcatttcctgg
ctgattgtacacatggaccatgttatctccaaggagctggaaacaaagatgaacatacag
aacatttctatagtgctcagccctacggttcagattagcaatcgcgtcttgtatgtgttt
ttcacgcatgtgcaagagctctttggaaatgtggtactaaaacaagtgacaaagcctctc
cggtggtctaacatggccactatgcctaccctgccggacacccaggagagcatcaaggag
gagatcagaagacaggagtttcttttgaattgtttacatcgagatttgcagggtgggata
aaggatttatctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaagaatgtgaaaccaagattgcacaagagatagct
agtctttcaaaagaggatgtttccaaagaagaaatgaatgaaaatgaagaagttataaat
attctccttgcccaggagaatgagatcttgactgaacaggaggaacttctagccatggag
cagtttctgcgccggcagatcgcctcagagaaagaagaaatagaacgcctcagagctgag
attgctgaaattcagagtcgtcagcaacatggtcgaagtgaaactgaggagtattcctct
gacagtgagagtgagagtgaagatgaagaagagctgcagatcattctggaggatttacag
agacagaatgaggagctggaaataaagaacaatcacttgaatcaagcaatccacgtagag
cgagaggccatcattgagctgcgagtgcagctccggctgctgcagctgcagcgggctcag
tctgagcagcaggtgcaggacgaagaggagcctgagaggcgtgggggtggagctcagccg
ccaagagacagtgttctcgagacaaaggcaacgaaagagcagccaaaggccgtcaaggag
caaggaaagccgtcaccgagcaaagacaggaaggaaacacccatttga

DBGET integrated database retrieval system