KEGG   Loxodonta africana (African savanna elephant): 100674054
Entry
100674054         CDS       T04351                                 

Gene name
FGFR3
Definition
(RefSeq) fibroblast growth factor receptor 3 isoform X1
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04144  Endocytosis
lav04151  PI3K-Akt signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04810  Regulation of actin cytoskeleton
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05219  Bladder cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100674054 (FGFR3)
   04014 Ras signaling pathway
    100674054 (FGFR3)
   04015 Rap1 signaling pathway
    100674054 (FGFR3)
   04020 Calcium signaling pathway
    100674054 (FGFR3)
   04151 PI3K-Akt signaling pathway
    100674054 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100674054 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100674054 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674054 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674054 (FGFR3)
   05206 MicroRNAs in cancer
    100674054 (FGFR3)
   05230 Central carbon metabolism in cancer
    100674054 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    100674054 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100674054 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100674054 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100674054 (FGFR3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100674054 (FGFR3)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100674054 (FGFR3)
CD molecules [BR:lav04090]
 Proteins
  100674054 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Pkinase_fungal
Other DBs
NCBI-GeneID: 100674054
NCBI-ProteinID: XP_023405471
LinkDB
Position
Unknown
AA seq 808 aa
MGAPACALALCVAVAVVAGAASGPPGTELRVVRRAAEALEPEPGQKEQLVFGSGDTMELT
CHPPMGSTPGPTIWVKDGLGLVPSDRILVGLQRLQVLNASHEDAGAYSCRQRLTQRILCR
FSVRVTDAPSSGDDEDSEDEAEDTGVPVGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKSWISESAEADARLRLANVSERDGGEYLCRATNFIGVAEKAFWLRVHGPPA
AEEELAEADEASSVYAGVLSYGAGFFFFIMVVVAVTLCRLHSPTKKGLGSPAVHKVSRFP
LKRQVSLESNSSMNSNTPLVRMARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPL
GEGCFGQVVMAEAIGIDKERAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNI
INLLGACTQGGPLYVLVEYAAKGNLREYLRARRPPGMDYSFDTCKLPEEQLTFKDLVSCA
YQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPV
KWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPAN
CTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSVPFEQYSPGGQDTP
SSGSSGDDSVFAHDLLLPAPPSSGALRT
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgggcgccccggcctgcgccctcgctctctgcgtggccgtggccgtcgtggccggcgct
gcctcggggcccccgggcacagagctacgcgtcgtgaggagagcggcagaggccctggag
cctgagcctggccagaaagagcagctggtctttggcagtggggacaccatggagctgacc
tgccacccacccatgggcagtaccccaggacccaccatctgggtgaaggacggcttgggg
ctagtgccctcggaccgcatcctggtggggctgcagaggctacaggtgctcaacgcctcc
cacgaggacgctggcgcgtacagctgccgccagcggctcacccagcgcatcctgtgccgc
ttcagcgtgcgggtgacagatgctccgtcctcgggagatgacgaagacagtgaggacgag
gctgaggatacaggtgtgcctgtaggagccccttattggacacggcctgagcgcatggac
aaaaagctcttggccgtgccagcggccaacaccgtccgcttccgctgcccggccgctggc
aaccccacaccctccatatcgtggctcaagaacggcaaggaattccgtggcgagcaccgc
attgggggcatcaagctgcggcaccagcagtggagtctggtcatggagagtgtggtgccc
tccgaccggggcaactatacgtgtgtggtggagaacaagttcggcagcatccggcagacg
tacacgttggatgtgctcgagcggtccccgcaccggcccatcctgcaggcagggctgcca
gccaaccagacggcagtgctgggcagcgacgtggagttccactgcaaggtatacagcgac
gcccagccccacatccagtggctcaaacacgtggaggtgaacggcagcaaggtgggcccc
gacggcacaccctacgtcactgtgctcaagtcctggatcagtgagagtgcggaggctgac
gcgcgcctccgcctggccaatgtgtccgagcgggacgggggcgagtacctctgtcgagcc
accaatttcataggcgtggccgagaaggccttttggctgcgtgttcacgggcccccagca
gctgaggaggagctggcggaggcggacgaggccagtagcgtgtacgcaggcgttctcagc
tacggggcaggcttcttcttcttcatcatggtggtggtggccgtgaccctgtgccggctg
cacagcccgaccaagaagggcctgggctctcccgccgtgcacaaggtctcccgcttcccg
ctcaagcgacaggtgtccctggagtccaactcgtccatgaattccaacacgccactggtg
cgcatggccaggctgtcctcgggggagggccccacgctggccaacgtctctgagctcgag
ctgcctgccgaccccaagtgggagctgtcccgcgcccggctgaccctgggcaagcccctg
ggggagggctgcttcggccaggtggtcatggcagaggctatcggcatcgacaaagagcgg
gctgccaagcctgtcactgtggctgtgaagatgctgaaagacgatgccacggacaaggac
ctctcggacctggtgtcagagatggagatgatgaagatgattggcaagcacaagaacatc
atcaacctgctgggggcctgcacgcagggcgggcccctgtatgtgctggtggagtacgcg
gccaagggcaacctgcgggagtaccttcgggcgcggaggcccccgggcatggactactcc
tttgacacctgcaagttgcctgaggagcagctcaccttcaaggacctcgtgtcctgtgcc
taccaggtggcacggggcatggagtatctggcctcccagaagtgcatccacagggatctg
gccgcccgcaatgtgctggtgacagaggacaacgtgatgaagatagctgactttggcctg
gcccgggatgtgcacaacctggactactacaagaagaccaccaacggccggctgcccgtg
aagtggatggcacccgaggctctgtttgaccgagtctacacccaccagagtgacgtctgg
tcctttggtgtcctgctctgggaaattttcacgctggggggctcaccataccccggcatt
cccgtggaggagctcttcaagctgctcaaggaaggccaccgcatggacaagccagccaac
tgcacacacgacctgtacatgatcatgcgagagtgctggcatgctgtgccctcccagcgg
cccaccttcaagcagctggtggaggacctggaccgtgtgctcactgtgacgtccactgac
gagtacctggacctgtcagtgccatttgagcagtactcgcctggtggccaggacacaccc
agctccggctcctcgggcgatgactctgtgtttgcccacgaccttctgctgcctgccccc
cccagcagcggggctctgcggacgtga

DBGET integrated database retrieval system