KEGG   Loxodonta africana (African savanna elephant): 100674245Help
Entry
100674245         CDS       T04351                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04114  Oocyte meiosis
lav04140  Autophagy - animal
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04340  Hedgehog signaling pathway
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04910  Insulin signaling pathway
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04976  Bile secretion
lav05012  Parkinson disease
lav05020  Prion diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100674245 (PRKACA)
   04010 MAPK signaling pathway
    100674245 (PRKACA)
   04310 Wnt signaling pathway
    100674245 (PRKACA)
   04340 Hedgehog signaling pathway
    100674245 (PRKACA)
   04371 Apelin signaling pathway
    100674245 (PRKACA)
   04020 Calcium signaling pathway
    100674245 (PRKACA)
   04024 cAMP signaling pathway
    100674245 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100674245 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100674245 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100674245 (PRKACA)
   04540 Gap junction
    100674245 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100674245 (PRKACA)
   04062 Chemokine signaling pathway
    100674245 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    100674245 (PRKACA)
   04910 Insulin signaling pathway
    100674245 (PRKACA)
   04922 Glucagon signaling pathway
    100674245 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    100674245 (PRKACA)
   04912 GnRH signaling pathway
    100674245 (PRKACA)
   04913 Ovarian steroidogenesis
    100674245 (PRKACA)
   04915 Estrogen signaling pathway
    100674245 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100674245 (PRKACA)
   04921 Oxytocin signaling pathway
    100674245 (PRKACA)
   04926 Relaxin signaling pathway
    100674245 (PRKACA)
   04918 Thyroid hormone synthesis
    100674245 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100674245 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100674245 (PRKACA)
   04916 Melanogenesis
    100674245 (PRKACA)
   04924 Renin secretion
    100674245 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100674245 (PRKACA)
   04927 Cortisol synthesis and secretion
    100674245 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100674245 (PRKACA)
   04270 Vascular smooth muscle contraction
    100674245 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    100674245 (PRKACA)
   04971 Gastric acid secretion
    100674245 (PRKACA)
   04976 Bile secretion
    100674245 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100674245 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100674245 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100674245 (PRKACA)
   04727 GABAergic synapse
    100674245 (PRKACA)
   04725 Cholinergic synapse
    100674245 (PRKACA)
   04728 Dopaminergic synapse
    100674245 (PRKACA)
   04726 Serotonergic synapse
    100674245 (PRKACA)
   04720 Long-term potentiation
    100674245 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100674245 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    100674245 (PRKACA)
   04742 Taste transduction
    100674245 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100674245 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    100674245 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100674245 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100674245 (PRKACA)
   04714 Thermogenesis
    100674245 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674245 (PRKACA)
   05205 Proteoglycans in cancer
    100674245 (PRKACA)
   05203 Viral carcinogenesis
    100674245 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100674245 (PRKACA)
   05020 Prion diseases
    100674245 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    100674245 (PRKACA)
   05031 Amphetamine addiction
    100674245 (PRKACA)
   05032 Morphine addiction
    100674245 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100674245 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100674245 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100674245 (PRKACA)
   05163 Human cytomegalovirus infection
    100674245 (PRKACA)
   05165 Human papillomavirus infection
    100674245 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100674245 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100674245 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100674245 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100674245 (PRKACA)
   03036 Chromosome and associated proteins [BR:lav03036]
    100674245 (PRKACA)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100674245 (PRKACA)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKA family
   100674245 (PRKACA)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100674245 (PRKACA)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100674245 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Peptidase_C3
Motif
Other DBs
NCBI-GeneID: 100674245
NCBI-ProteinID: XP_003413099
UniProt: G3SUV1
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VRHKDIGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtcaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcccgcccagaatacagcccac
ttggatcagtttgaacgaatcaagaccctgggcacgggctcctttgggcgggtgatgctg
gtgaggcacaaggacattgggaaccactacgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagatagagcataccctgaatgaaaagcgcatcctgcaagcggtcagc
tttccgttcctcgtcaaactcgagttctccttcaaggacaactccaacttatacatggtc
atggagtatgtgcccggtggggagatgttctcacacctacggaggattggaagattcagc
gagccccatgcccgcttctacgcagcccagatcgtcctgacctttgagtacctgcattca
cttgatctcatctaccgggacctgaagccggagaacctcctcatcgaccagcagggctac
attcaggtgacagacttcggttttgccaagcgtgtcaaaggccgcacctggaccttgtgt
gggacccccgagtatctggcccctgagattatcctaagcaaaggctacaacaaggctgtg
gactggtgggccctgggggtcctcatctatgagatggcagccggctacccacccttcttt
gccgaccagcccatccagatctacgagaagatcgtctctgggaaggtgcggttcccgtca
cacttcagctccgacctgaaagatctactgcggaatctcctgcaggtggacctcaccaag
cgcttcgggaacctcaagaatggagtcaatgacatcaagaatcacaagtggtttgccacg
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccccggagacacgagtaacttcgacgactatgaggaggaagagatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system