KEGG   Loxodonta africana (African savanna elephant): 100674374
Entry
100674374         CDS       T04351                                 

Gene name
CHRM1
Definition
(RefSeq) LOW QUALITY PROTEIN: muscarinic acetylcholine receptor M1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04725  Cholinergic synapse
lav04810  Regulation of actin cytoskeleton
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100674374 (CHRM1)
   04024 cAMP signaling pathway
    100674374 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100674374 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674374 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674374 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100674374 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100674374 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    100674374 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100674374 (CHRM1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100674374 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100674374
NCBI-ProteinID: XP_010597404
LinkDB
Position
Unknown
AA seq 462 aa
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYPPGSRFMCTLYWRIYRGDREPEHRELAALQGSETPGKGGGSS
SSSERSQPGAEGSPETLPGRCCRCCRTPRLLQAYSWKEEEEEDEGSMESLTSSEGEETGS
EVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKGRERAGKGPKPRGKEQLAKRKTFSLV
KEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCY
ALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaacacctcagccccgcccgccgtcagccccaacatcactgtcctggcaccgggaaag
ggtccatggcaagtggccttcattgggatcaccactggcctcctgtcactggccacggtg
acaggcaacctgctggtgctcatctccttcaaggtcaacacagagctcaagacggtcaac
aactacttcctgctgagcctggcctgtgccgacctcatcatcggcaccttctccatgaac
ctctacaccacctacctgctcatgggccactgggctctgggcacgctagcctgcgacctc
tggctggccctggactatgtggccagcaatgcctctgtcatgaacctgctgcttatcagc
tttgaccgatacttctccgtgacgcggcccctgagctaccgtgcaaagcgcacgccccgc
cgggcggccctcatgatcggcctggcctggctggtttccttcgtcctctgggccccagcc
atcctcttctggcagtacctggtgggtgagcggacagtgctggccgggcagtgctacatc
cagtttctctcccagcccatcatcaccttcggcacagccatggctgccttctaccctccc
gggtcacggttcatgtgcacgctctactggcgcatctaccggggagaccgagaacccgag
caccgggagctggcagccctgcaaggctcggagacaccaggcaagggaggcggcagcagc
agcagctcagagcggtcccagccaggggcagagggctcccctgagaccctcccagggcgc
tgctgccgctgctgccggaccccccggctgctgcaggcctacagctggaaggaggaagag
gaggaggacgaaggctccatggagtccctcacgtcctccgagggtgaggagaccggctcc
gaggtggtgatcaagatgcccatggtggaccctgaggcacaggcccccgccaagcagccc
ccccggagctccccaaatacagtcaagaggcccacccggaaggggcgggagcgagctggc
aagggcccaaagccccgtgggaaggagcagctggccaagcggaagaccttctcactggtc
aaggagaagaaggcggctcggaccctgagtgccatcctgttggccttcatcctcacctgg
acaccatacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcctgagacc
ctgtgggagctgggttactggctgtgctacgtcaacagcaccatcaaccccatgtgctat
gcactctgcaacaaagccttccgggacaccttccgcctgctgctgctctgccgctgggac
aaacgtcgctggcgcaagatccccaagcgccctggttctgtgcaccgcaccccctcccgc
caatgctga

DBGET integrated database retrieval system