KEGG   Loxodonta africana (African savanna elephant): 100674384Help
Entry
100674384         CDS       T04351                                 

Gene name
TGM1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100674384 (TGM1)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100674384 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100674384
NCBI-ProteinID: XP_003421051
LinkDB All DBs
Position
Unknown
AA seq 847 aa AA seqDB search
MELDWVGILGKEVSRWVCSLGVWSESPCLSLTGTMMDGPRSDVGRWGRSPWQPTATPSPE
PEPEPDRRSRGSGRSFWARCCSCCSSRNVDDDWGRGSGARVSGSRDRGSSSGGRRPDSRG
SDSHRPVSRGTGVNAAGDGTVREGMLVVTGVDLLSSRSDQNRREHHTDEFEYNELIVRRG
QPFDIVLFLSRPYGSSDHITLELLIGNNPEVGKSTHVIIPVGKGGSGGWKAQVIKANGQN
LNLRVYTSPNSIIGKFQFTVRTHSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWR
QEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLCILDRRGMPYGGRGDPVSVSRV
ISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVT
TTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNRDSVWNFHVWNDCWMK
RPDLPSGFNGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVY
WQRQDDGSFKIVYVEEKAIGTLIITKAIGSNMRDDVTHLYKHPEGSEAERKAVETAAAHG
SKPNVYATRDSAEDVAVQVETQDVVTGQDLTVCVVLSNRGSSRRTVKLHLYLSVTFYTGV
TGPVFKDSKKEVVLEPGASERVVMPVAYQEYQPHLVDQGAMLLNISGHVKENGQVLAKQH
TFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGLG
KAQCPTFMPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGGWALSDPGGDSHSGETIP
MASRGGA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagctggactgggtgggcatactgggtaaggaggtttccaggtgggtttgttctctg
ggtgtgtggtcagagtccccctgcctctcccttacaggcacaatgatggatggtcctcgg
tcggacgtgggccgctggggtaggagcccctggcagcccactgccacaccttcgccagag
ccagagccagagccagacaggcgttcccggggctccggccgatccttctgggctcgctgc
tgtagctgctgctcaagccggaatgtggatgatgactggggccgagggtccggggcccga
gtgtctggctccagggaccgagggtccagctctgggggccgcagacctgactcccggggc
tcagactctcatcggcctgtctcccggggcaccggtgtgaacgcagctggagatggcacc
gtccgagagggcatgctggtggtgaccggtgtggatttgctgagttcacgctccgaccag
aaccgccgagagcatcacacagacgagttcgagtataacgagctgattgtgcgccgtgga
cagcctttcgacatcgtgcttttcctgtcccggccctatgggtcctcagatcacatcacc
ctggagctgctcattggcaacaaccctgaggtgggcaagagcacccacgtgatcatccca
gtgggtaaggggggcagcggaggctggaaggcccaggtgatcaaagccaatgggcagaat
ctgaacctgcgggtttacacctcccccaactccatcatcggcaagtttcagttcacggta
cgcacgcactcagatgccggagagttccaattgccctttgacccccgcaacgagatctac
atcctcttcaacccctggtgcccagaggacattgtgtatgtggaccacgaggactggagg
caggagtatgtgcttaatgagtccgggagaatttattacgggactgaagcgcagattggc
gagcgcacctggaactacggccagtttgaccatggggtgctggacgcctgtctgtgcatc
ctggaccggcgggggatgccatatgggggccgcggggacccagtcagtgtctcccgggtc
atctccgccatggtaaactccctggatgacaatggggtcctgattggaaactggtctggc
gattactcccgaggcaccaacccgtcagcgtgggtgggcagtgtggagatcctactcagc
tacctacgcacgggctattctgtcccctatggccagtgctgggtttttgctggtgtgacc
acgacagtgctgcgttgcctgggcctggccactcggactgtcaccaacttcaactccgca
catgacacagacacatccctcaccatggacatctactttgatgagaacatgaagccactc
gagcacctgaatcgtgattctgtttggaactttcacgtgtggaatgactgctggatgaaa
aggccggatttgccctcgggcttcaatgggtggcaggtggtagatgccacaccccaggag
accagcagtggcatcttctgctgtggcccctgctccgtggagtccatcaagaatggcctg
gtctatatgaagtacgacacacccttcatttttgctgaggtgaacagtgacaaggtatac
tggcagcggcaagatgatggcagcttcaagattgtgtacgtggaggagaaggccattggt
acactcatcatcacgaaggccattggctccaacatgcgggacgacgtcacccacctctat
aagcacccagaaggctccgaggccgagcggaaagcagtggagacagcagctgcccatggc
agcaaacccaacgtgtatgccacgcgcgactcagctgaggatgtggcagtacaagtggag
acacaggacgtggtgacagggcaggatctgacagtctgtgtggtgctgagcaatcgtggc
agcagccgccgcaccgtgaagctgcacctctacctctcggtcaccttctacacgggcgtc
actgggcccgtcttcaaagacagcaagaaggaagtggtcctggagccaggggcctcggaa
cgtgtggtcatgccggtggcctaccaggaataccagccccaccttgtagaccagggggcc
atgctgctcaacatctcgggccacgtcaaggagaacgggcaggtgctggccaagcagcat
accttccgtctgcgcacccctgacctctccctcacgttattgggagcagctgtggttggc
caggagtgtgaagtacagattgtcttcaagaaccctctgcctgtcacccttacgaatgtc
gtcttccggctcgagggctccgggttacagaggcccaagatcctcaacgtcgggctgggc
aaggcccagtgcccaacattcatgcctgtgcgcccaggcccccgccagctcatcgccagc
ttggacagcccacagctctcccaggtgcacggtgtcatccaggtggacgtggccccagcc
tccggaggctgggctctctcagaccctggaggcgacagtcactccggggagaccatccct
atggcatctcgaggtggggcttag

DBGET integrated database retrieval system