KEGG   Loxodonta africana (African savanna elephant): 100674484
Entry
100674484         CDS       T04351                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04630  JAK-STAT signaling pathway
lav04640  Hematopoietic cell lineage
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04672  Intestinal immune network for IgA production
lav05140  Leishmaniasis
lav05200  Pathways in cancer
lav05310  Asthma
lav05320  Autoimmune thyroid disease
lav05321  Inflammatory bowel disease
lav05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100674484 (IL4)
   04151 PI3K-Akt signaling pathway
    100674484 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100674484 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100674484 (IL4)
   04660 T cell receptor signaling pathway
    100674484 (IL4)
   04658 Th1 and Th2 cell differentiation
    100674484 (IL4)
   04659 Th17 cell differentiation
    100674484 (IL4)
   04657 IL-17 signaling pathway
    100674484 (IL4)
   04664 Fc epsilon RI signaling pathway
    100674484 (IL4)
   04672 Intestinal immune network for IgA production
    100674484 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674484 (IL4)
  09163 Immune disease
   05310 Asthma
    100674484 (IL4)
   05320 Autoimmune thyroid disease
    100674484 (IL4)
   05321 Inflammatory bowel disease
    100674484 (IL4)
   05330 Allograft rejection
    100674484 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100674484 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100674484 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100674484 (IL4)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interleukins
   100674484 (IL4)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Haparin
  Cytokines
   100674484 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 100674484
NCBI-ProteinID: XP_003404796
LinkDB
Position
Unknown
AA seq 111 aa
MGLTSQLIPTLLCLLVCTSNFIHGQTCGNILREIIKTLNFLTEKKHACTELTVADAFAAP
KNTTEKETFCRATTVLWQVSKRHECFTKYLRGLSRSLSSMTNLDYCPVNED
NT seq 333 nt   +upstreamnt  +downstreamnt
atgggtctcacctctcaactgattccaactctgttgtgcctactagtatgtaccagcaac
ttcatccacggccaaacatgtggtaatatcttaagagagatcatcaaaactttgaacttc
ctcacagagaaaaagcatgcgtgcaccgagttgactgtagcagacgcctttgctgccccg
aagaacacaaccgagaaagaaaccttctgcagagctactactgtgctttggcaggtctct
aaacgccacgaatgctttaccaaatacctgagaggactcagtagaagcctcagcagcatg
acaaacctggattactgtcctgtgaatgaagac

DBGET integrated database retrieval system