KEGG   Loxodonta africana (African savanna elephant): 100674622
Entry
100674622         CDS       T04351                                 

Gene name
PTH
Definition
(RefSeq) parathyroid hormone
  KO
K05261  parathyroid hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04928  Parathyroid hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674622 (PTH)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100674622 (PTH)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100674622 (PTH)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100674622 (PTH)
SSDB
Motif
Pfam: Parathyroid ABC_ATPase zf-RING_9
Other DBs
NCBI-GeneID: 100674622
NCBI-ProteinID: XP_003412047
UniProt: G3TZR3
LinkDB
Position
Unknown
AA seq 115 aa
MMSAKDLAKVMVVLFAICFLTELEGKPVMRRSVSEIQFMHNLGKHLTSMERVEWLRKKLQ
DVHNFIALGAPAAPRDGGSQRPRKKEDNVLVDSNQKSLGEVDKADVDVLIKAKSQ
NT seq 348 nt   +upstreamnt  +downstreamnt
atgatgtctgcaaaagacctggctaaagtaatggttgtcttgtttgcaatttgttttctt
accgaactggaagggaaacctgttatgaggagatctgtgagtgaaatacagtttatgcac
aacctgggcaaacatctgacctcaatggaaagagtggagtggcttcgtaagaaactgcag
gatgtgcacaattttattgccctcggagcccctgctgctcccagagatggtgggtcccag
aggccccgaaaaaaggaagacaacgtcctggttgacagtaatcaaaaaagtcttggagag
gtagacaaagctgatgtggatgtattaatcaaagctaaatcccaatga

DBGET integrated database retrieval system