KEGG   Loxodonta africana (African savanna elephant): 100674677
Entry
100674677         CDS       T04351                                 

Gene name
GLP1R
Definition
(RefSeq) glucagon-like peptide 1 receptor
  KO
K04581  glucagon-like peptide 1 receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100674677 (GLP1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674677 (GLP1R)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100674677 (GLP1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100674677 (GLP1R)
G protein-coupled receptors [BR:lav04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    100674677 (GLP1R)
SSDB
Motif
Pfam: 7tm_2 HRM Dicty_CAR DinB_2
Other DBs
NCBI-GeneID: 100674677
NCBI-ProteinID: XP_023400534
LinkDB
Position
Unknown
AA seq 557 aa
MPARPWPSRLALLLLGAVSRAGLRPQVSLRTLGGQGRGRWRCGLQAQCPGRGGQDLSETP
CPQAEGANSLWGTSCPAVAGADFCGRSSSSPNHFPNSAFLFLNRGWAGWTHGAPISGFPQ
GATVSLSETVQKWREYRRQCQRFLNEAPSPATGLFCNRSFDDYACWPDGTPGSFVNVSCP
WYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGEKSTPEEQLLSLYV
IYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSIFIKDTALKWMYS
TAAQQHQWDGLLSYQDSVGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLALSVFSEQRIF
RLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVR
VICIVVAKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVIDEHARGTLRFIKLFT
ELSFTSFQGLMVAILYCFVNNEVQMEFRKSWERWRLEHLHNQRDSSMKPLKCPTTSLSSG
GTVGSSVYTATCQASCS
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgccggcacgcccctggccctcccgcctcgcactcctgctgctcggggcggtgagcagg
gccggcctccgcccccaggtgagcctgcggaccctggggggacaggggagagggaggtgg
cgctgcgggctgcaggcgcagtgtcctggcaggggcggccaggacttgagcgaaactccg
tgtccgcaggcggagggagccaatagcctctggggcaccagctgccccgcggtcgccggc
gctgacttctgtggcaggtcttcgtcctccccaaaccactttcccaactccgccttcctc
ttcttaaaccggggatgggctggctggacccatggggcccccatttctggcttcccccag
ggtgccactgtatccctctcggagactgtgcagaaatggcgagaataccgacgccagtgc
cagcgcttcctgaatgaggctccatccccagctacaggcttgttctgcaaccggagcttt
gatgactatgcctgctggccagatgggacaccgggctcctttgtgaacgtcagctgcccc
tggtacctgccctgggccagcagtgtgttgcagggccatgtgtaccggttctgcacagct
gagggcctgtggctgcacaaggacaactccagcttgccctggagggacctgtcggagtgc
gaggagtccaagcgaggggagaaaagcaccccggaggagcagctcctgtccctttacgtc
atctacaccgtgggctacgcgctctccttttccgctctggtcatagcttcggccatcctt
ctaggattcagacacctgcactgcacccggaactacatccacctgaacctatttgcatcc
ttcatcctccgagctctgtccatcttcatcaaagatacagccctcaagtggatgtacagc
acggctgcccagcagcaccagtgggatgggcttctctcctaccaggactctgtgggctgc
cgcctggtgttcctgctcatgcagtactgcgtggcggccaattactactggctcctggtg
gagggtgtgtacctgtacacgctgctggccctctcagtcttctccgagcagcgcatcttc
aggctgtatctgagcataggctggggtgttcccctgctgtttgttatcccctggggcatc
gtcaagtacctctatgaggatgagggttgctggaccaggaactcaaacatgaactactgg
ctcattatccggctgcccattctctttgccattggagtgaacttcctcatctttgtccgg
gtcatctgcatcgtggtggccaaactgaaggccaatctcatgtgcaagacagacatcaag
tgcagacttgccaagtccacgttgacgctcatccccctgctggggacgcacgaggtcatc
tttgccttcgtgatagacgagcacgcccgggggacgctgcgcttcatcaagctgttcaca
gagctctccttcacctccttccaggggctgatggtggccatcttgtactgctttgtcaac
aatgaggtccagatggagtttcggaagagctgggagcgctggcggctggagcatctgcac
aaccagagggacagcagcatgaagcccctcaagtgtcccaccaccagcctgagcagcgga
ggcaccgtgggcagcagtgtgtacacagccacctgccaggcttcctgcagctaa

DBGET integrated database retrieval system