KEGG   Loxodonta africana (African savanna elephant): 100674695
Entry
100674695         CDS       T04351                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin B5
  KO
K10139  serpin B5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100674695 (SERPINB5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100674695 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100674695 (SERPINB5)
Peptidases and inhibitors [BR:lav01002]
 Peptidase inhibitors
  Family I4: serpin family
   100674695 (SERPINB5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100674695
NCBI-ProteinID: XP_003406314
UniProt: G3T7I5
LinkDB
Position
Unknown
AA seq 398 aa
MQFRTLTDILKINLSLVFGSRPTMDALRLANSAFAVDLFKQLCEKEPAGNVLFSPICLST
SLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKS
LNPSTEFMSSTKRPYAKEMETVDFKDKIEETKSQINKSINELTDGRFENILAENSVNDQT
KILVVNAAYFVGKWMKKFPESETKERPFRVNKTDTKPVQMMNMEATFCMGHIDDINCKII
ELPFQNKHLSMLILLPKDMEDESTGLEKVEKQLNAETLLQWTNPSTMANAKVKLSIPKFK
VEKVIDPKASLENLGLKNAFNENASDFSGMSETKGVALSNVVHRVCLEITEDGGDSIEVP
GSRILQHKDEFNADHPFIYIIRHNKTRNIIFFGKFCSP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgcagttcagaacacttacagatattttaaaaataaacctgtcccttgtctttggttcc
aggcccacaatggatgccctgagactggcaaactctgcttttgcagttgacctgttcaaa
cagctgtgtgaaaaggagccggcaggcaatgtcctcttctctccaatctgtctctctacc
tccctgtcacttgctcaagtaggtgccaaaggtgacacagcaaatgaaattggacaggtc
cttcattttgaaaatgtcaaagatgtgccctttggatttcaaacagtaacatcggatgta
aacaaactcagttccttttattcactgaaactcatcaaacggctctacgtagacaaatct
ctgaatccttctacagagttcatgagttcaacaaagagaccctatgccaaagaaatggaa
accgttgacttcaaagataaaatagaagaaacgaaaagtcaaatcaacaaatcaattaat
gaactcacagatggccgctttgagaacattttagctgaaaacagcgtcaacgaccagacc
aaaatccttgtggtaaatgccgcctactttgttgggaagtggatgaagaaatttcctgaa
tcggaaacaaaagaacgccctttcagagtcaacaagacagacaccaaaccagtgcaaatg
atgaatatggaggctacgttctgtatgggccacattgacgatatcaactgtaagatcatt
gagcttccttttcaaaataagcacctgagcatgctcatcctgctacccaaggatatggag
gatgagtcgacaggcctggaaaaggttgaaaaacaactcaacgcagagacactgttgcag
tggaccaaccccagcaccatggccaacgccaaagtcaaactctctattccaaaatttaag
gtggaaaaggtgattgaccccaaggctagtctggaaaacctagggctgaaaaatgccttt
aatgaaaatgcatctgatttctctggaatgtcagagaccaagggagtagccctatcaaat
gtggtccacagagtgtgcttagaaataaccgaagatgggggggattccatcgaggtgcca
ggatcacgcatcctgcaacacaaagacgaattcaatgccgaccacccgttcatttacatc
atcaggcacaacaaaactcgaaacatcattttctttggcaagttctgttctccttaa

DBGET integrated database retrieval system