KEGG   Loxodonta africana (African savanna elephant): 100674705Help
Entry
100674705         CDS       T04351                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04611  Platelet activation
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy (HCM)
lav05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
lav05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100674705 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100674705 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100674705 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674705 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674705 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100674705 (ITGA2)
   04611 Platelet activation
    100674705 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674705 (ITGA2)
   05205 Proteoglycans in cancer
    100674705 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100674705 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100674705 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100674705 (ITGA2)
   05414 Dilated cardiomyopathy (DCM)
    100674705 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674705 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100674705 (ITGA2)
   04515 Cell adhesion molecules [BR:lav04515]
    100674705 (ITGA2)
   04090 CD molecules [BR:lav04090]
    100674705 (ITGA2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100674705 (ITGA2)
  Exosomal proteins of bladder cancer cells
   100674705 (ITGA2)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100674705 (ITGA2)
CD molecules [BR:lav04090]
 Proteins
  100674705 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha HisK_sensor
Motif
Other DBs
NCBI-GeneID: 100674705
NCBI-ProteinID: XP_010586441
LinkDB All DBs
Position
Unknown
AA seq 1183 aa AA seqDB search
MRPGRAESELLRLRLRLVLMFSQGILNCCVAYNVGLPEAKIFSGPSSEQFGYAVQQFINP
KGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLT
LTRNVGTGGFLTCGPLWAQQCGNQYYTTGVCSEVSPDFQHLASFSPAVQTCPSFIDVVVV
CDESNSIYPWDAVKSFLEKFVQGLDIGPQKTQVGLIQYGNNPRVVFNLNTYKTKAEMIKA
TTRTYQHGGDLTNTFKAIQYARDFAYSAAAGGRPHATKVMVVVTDGESHDGSMLKAVIEQ
LNNDNILRFGIAVLGYLNRNTLDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLG
EQIFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAYAWSGTIVQQTSRGHLI
FPKQAFDQILQDRNHSSYLGYSVAVISTRKNIHFVAGAPRANYTGQIVLYRVDENGNVTI
IQPHRGDQIGSYFGSVLCSVDVDRDTITDVLLVGAPMYMNDLKKEEGRVYLFTITKGILN
HHQFLEGPEGFENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQSTIRT
KYSQKILGSDRAFRSHLQYFGRSLDGHGDLNGDSITDVSIGAFGQVVQLWSQSIADVSVE
AFFTPEKITLLKKNAEIILKLCFSAKFRPTNQINQVAITYNVTLDADRFSSRVTSRGLFK
ENNERFLQRNMVVNQAQSCSEHIIHVQEPSDVVNPLDLRVNISLENPGTSPALEAYSETA
KVFRIPFYKDCGDDGLCISDLVLSVQQLPADQKQPFIVSNQHKRLTFSVTLKNKKESAYN
TRIVAAFSENLFFASSSMPVDGTEVTCQVDSSQKSVTCNVGYPALKRKQQVTFTVNFDFN
LQNPQNQASVSFQALSESHEENQADNLVTFKIPLLYDADIHLTRSTSINFYEVSSDGKVP
SIIHDFEDIGPKFTFSLKVTTGGAPVSMAYVTIHIPQYTKEKNPLMYLTGVQTDQAGDIG
CNAEINPLKIGQASSSVSFKSENFRHMKELNCRTASCSSVTCWLKDLQAKGEYFVNVSTR
IWNGTFAASTFQAIQLTGSAEIDTYNPQIYVIEENTVMIPVIIMKPGEKAEVPTGVIVGS
IIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDEMTEINS
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccaggacgcgcggagagcgagctgctgcggctgcggctgcggctggtactaatg
ttcagtcaaggaattttaaattgttgcgtggcatacaatgttggtcttccagaagcaaaa
atattttctggtccttcaagtgaacagtttggctatgcagtgcagcagtttataaaccca
aagggaaactggttactggttggttcaccttggagtggctttcctgagaaccgaatggga
gacgtgtataaatgtcctgttgatctatccactgctacatgtgaaaaactgaatttgcaa
acttcaaccagcattccaaatgttactgagatgaaaaccaacatgagccttggcttgacc
ctcacaaggaacgtgggaaccggagggtttctaacatgtggtcccctatgggcacagcag
tgtggaaatcagtattacacaaccggcgtttgctctgaggtcagtcctgattttcagcac
ttggccagcttttcacctgcagttcagacctgcccttccttcatagatgtggtggttgta
tgtgatgaatcaaatagtatttatccgtgggatgcagtaaagagttttttggaaaaattt
gtacaaggcctggacataggcccccaaaaaacacaggtggggttaattcaatatggcaat
aacccaagagttgtgtttaacctgaatacttataaaaccaaagctgaaatgattaaagca
acaacccgaacgtaccaacatggtggggacctcacaaatacattcaaagcaattcaatat
gcaagagattttgcttattcagcagctgctggtggacgaccacatgctaccaaagtaatg
gtggttgtaactgatggtgaatcacacgatggttcaatgttgaaagcagtgattgaacag
ttaaacaatgacaatatactgaggtttggcatagcagttcttggatacttaaacagaaac
acccttgatactaaaaatttaataaaagaaataaaagcaattgccagtattccaacagaa
agatactttttcaatgtgtctgatgaagcagcactactagaaaaggctgggacattagga
gaacaaattttcagcattgaaggtactgtccaaggaggagacaacttccagatggaaatg
tcacaagtgggattcagcgcagattactctccacaaaatgatattctgatgctgggtgca
gtgggagcttatgcctggagtggaactattgtccagcagacatctcgtggacatttgatc
tttcctaaacaagccttcgatcaaattctgcaagacagaaaccacagttcatatttaggt
tactctgtggctgtgatttctactagaaaaaacatccactttgttgctggtgctcctcga
gcaaattatactggccagatagtgctataccgtgttgacgagaatggtaatgtcacaatt
attcagcctcacaggggtgaccagattggctcctattttggtagtgtgctgtgttcagtg
gatgtggatagagacaccattacagatgtactcttagtaggtgcaccaatgtatatgaat
gacctgaagaaagaggaaggaagagtctacctatttactatcacaaagggcattttgaac
catcaccaatttcttgaaggccctgaaggctttgaaaatgctcgctttggctcagcaatt
gcagctctttcagacatcaacatggatggctttaatgatgtgatagttggttcaccttta
gagaatcagaactctggagctgtgtatatctacaatggtcatcagagcaccattcgcaca
aagtattcccagaaaatcttgggatccgatagagcttttagaagtcatctccaatacttt
gggagatccttggatggccatggagatttaaatggggattccatcactgacgtgtctatc
ggtgcctttggacaagtggttcaactctggtcacagagcatcgctgatgtatctgtagaa
gcttttttcacaccagaaaaaatcactttgctcaagaagaatgctgaaataattctcaaa
ctctgtttcagtgcaaaatttagacctactaatcaaatcaatcaagtggctattacatat
aacgtcaccctcgatgcagatcgattttcatccagagtgacctccaggggattatttaaa
gaaaataatgaaagattcctgcagaggaatatggtggtaaatcaagcacagagttgctct
gagcacatcatccatgtgcaggagccctctgatgttgtcaaccctttggatctgcgtgtg
aacatcagcctggagaaccctggcactagtcctgcccttgaagcctattctgagacagcc
aaggtcttcaggattcctttctataaagattgtggtgatgatggactttgcatttctgat
ctagttctcagtgttcagcagctcccagctgatcaaaaacaaccctttattgtcagcaac
caacacaaaaggttaacattttcagtaacactaaaaaacaaaaaggagagtgcatacaac
acaagaattgttgctgctttttcagaaaacttgttttttgcttcgtcctctatgccggtt
gatgggacagaagtcacatgccaggttgattcatctcagaaatctgttacctgcaatgta
ggctaccctgctttaaaaaggaaacaacaggtgacttttactgttaacttcgacttcaat
cttcaaaaccctcagaatcaggcatctgtcagtttccaagccctaagtgaaagccatgaa
gaaaatcaggcagataatttggtcaccttcaaaattcctctgctgtatgatgctgacatt
cacttaacaagatctaccagcataaatttttatgaagtttcttcagatggtaaagttcct
tccatcatacatgattttgaagatattggtccaaaattcaccttctcccttaaggtaaca
acaggaggtgcgccagtaagcatggcatatgtgaccatccacatccctcaatatacaaaa
gaaaagaacccactgatgtacctgactggggtgcagacagaccaggctggtgacatcggt
tgtaatgcagaaataaatccactgaaaataggacaagcatcttcttctgtatctttcaag
agcgaaaatttccggcatatgaaagaattgaattgcagaactgcttcatgtagcagtgtt
acctgctggctgaaagaccttcaggcgaaaggagaatactttgttaatgtgtctaccaga
atctggaatgggacttttgcagcatcaactttccaggcaatacagctgacagggtctgca
gaaattgacacctataaccctcagatatatgtgattgaagaaaacaccgtcatgattcct
gttataataatgaagcctggtgagaaagctgaagtaccaacaggagttatagtaggaagc
ataattgctggaatccttttgctcttagctctggttgcaattttatggaagctcggcttc
ttcaaaagaaaatatgaaaaaatgaccaagaatcctgatgagattgatgagatgacagaa
ataaacagttga

DBGET integrated database retrieval system