KEGG   Loxodonta africana (African savanna elephant): 100674799
Entry
100674799         CDS       T04351                                 

Gene name
FOS
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04024  cAMP signaling pathway
lav04210  Apoptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04713  Circadian entrainment
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04932  Non-alcoholic fatty liver disease
lav04935  Growth hormone synthesis, secretion and action
lav05031  Amphetamine addiction
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05224  Breast cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05323  Rheumatoid arthritis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100674799 (FOS)
   04668 TNF signaling pathway
    100674799 (FOS)
   04024 cAMP signaling pathway
    100674799 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100674799 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100674799 (FOS)
   04660 T cell receptor signaling pathway
    100674799 (FOS)
   04658 Th1 and Th2 cell differentiation
    100674799 (FOS)
   04659 Th17 cell differentiation
    100674799 (FOS)
   04657 IL-17 signaling pathway
    100674799 (FOS)
   04662 B cell receptor signaling pathway
    100674799 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100674799 (FOS)
   04917 Prolactin signaling pathway
    100674799 (FOS)
   04921 Oxytocin signaling pathway
    100674799 (FOS)
   04926 Relaxin signaling pathway
    100674799 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100674799 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100674799 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100674799 (FOS)
   04728 Dopaminergic synapse
    100674799 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100674799 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100674799 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674799 (FOS)
   05231 Choline metabolism in cancer
    100674799 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100674799 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100674799 (FOS)
   05224 Breast cancer
    100674799 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100674799 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100674799 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100674799 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100674799 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100674799 (FOS)
   05135 Yersinia infection
    100674799 (FOS)
   05133 Pertussis
    100674799 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100674799 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100674799 (FOS)
   05161 Hepatitis B
    100674799 (FOS)
   05171 Coronavirus disease - COVID-19
    100674799 (FOS)
   05162 Measles
    100674799 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100674799 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100674799 (FOS)
   05142 Chagas disease
    100674799 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100674799 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100674799 (FOS)
   04131 Membrane trafficking [BR:lav04131]
    100674799 (FOS)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100674799 (FOS)
Membrane trafficking [BR:lav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100674799 (FOS)
SSDB
Motif
Pfam: DUF3450 IFT20
Other DBs
NCBI-GeneID: 100674799
NCBI-ProteinID: XP_023402410
LinkDB
Position
Unknown
AA seq 325 aa
MTENGGIGGSVVEFSSPMWKAQVQLLANDFCTDLAASSANFIPTVTAISTSPDLQWLVQP
ALVSSVAPSQTRAPHPYGLHTPSAGAYSRAGIVKTTTGGRAQSIGRRGKVEQETDQLEDE
KSALQIEIANLLKEKEKLEFILAAHRPVCKRTDDLGFTEDMSVASLDLSXGLPEATTPES
EEAFTLHLLNDPEPKPSVEPVKSIRTMELKAEPFDDFLFPASSKPSSSETARSVPDMDMS
GSFYAADWEPLHSGSLGMGPLATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCA
AAHRKGSSSNEPSSDSLSSPTLLAL
NT seq 978 nt   +upstreamnt  +downstreamnt
atgacagaaaacgggggcattggtggttcagtggtagagttctcatctcccatgtggaag
gcccaggttcagctcctggccaatgatttctgcacggacctggctgcctccagtgccaac
ttcatccccacggtgactgccatctcaaccagccccgacctgcagtggctggtgcagccc
gccctcgtctcctccgtggccccatcgcagaccagagctccccacccctacggactccac
accccttcagcaggggcatactccagagcgggcattgtgaagaccacaacaggaggcaga
gcgcagagcattggcaggaggggcaaagtagaacaggagacagaccaactagaagatgag
aagtctgctctgcagattgagattgccaacttgctgaaagagaaggaaaaactagagttc
atcttggcagctcatcgacctgtctgcaagagaactgatgacctgggcttcactgaagac
atgtctgtggcttcccttgatcttagtnggggcctgccagaggctaccaccccggagtct
gaggaggccttcacgctgcatctcctcaatgatcctgaacctaagccctcagtggagccc
gtcaagagcatccgcaccatggagctgaaggccgagccctttgatgacttcctgttccca
gcatcatccaagcccagcagctctgagacagcccgctccgtgccagacatggacatgtct
ggctccttctatgcagcagactgggagcccctgcacagtggctccctggggatggggccc
ttggccacagagctggagcccctgtgcactccagtggtcacctgtactcccagctgcact
acttatacgtcttccttcgtcttcacctaccccgaggctgactccttccccagctgtgca
gcagcccatcgcaagggcagcagcagcaacgagccctcctctgactcgctcagctcaccc
acgctgctggccctgtga

DBGET integrated database retrieval system