KEGG   Loxodonta africana (African savanna elephant): 100674990
Entry
100674990         CDS       T04351                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav04935  Growth hormone synthesis, secretion and action
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100674990 (IGFBP3)
   04218 Cellular senescence
    100674990 (IGFBP3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100674990 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100674990 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100674990 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100674990 (IGFBP3)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    100674990 (IGFBP3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100674990 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 100674990
NCBI-ProteinID: XP_003407178
LinkDB
Position
Unknown
AA seq 290 aa
MERARPALWAAALAVLALLSGPPPARAGAGTGPVVRCEPCDARALEQCAPPPAAPACAEL
VREPGCGCCMTCALREGEPCGVYTERCGAGLRCQPPRGEPRPLQSLLDGRGLCTNSSALG
RLRAYLLHGPSASGNASESEEEHSAGSTENQELPSTHRVPDSKFHTLHTKIDVIKKGHAK
DSQRYKVDYESQSTDTQNFSSESKQETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCD
KKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKGKGDIHCYNMESK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagcgggcgcgtcccgcgctttgggccgcggcgctagcagtgctggcgctcctgagc
ggaccgccgcctgcgcgggccggggcgggcactggccccgtggtgcgctgcgagccgtgc
gacgcgcgcgcgctggagcagtgcgctccgccgcccgctgcgcctgcgtgcgccgaactg
gtgcgcgagccgggctgtggctgctgcatgacgtgcgcgctgcgcgaaggcgagccgtgc
ggcgtgtacaccgagcgctgtggcgcgggcctgcgctgccagccgccgcgcggagagccg
cgcccgttgcagtcgctgctggacggccgcgggctctgcaccaactccagcgctttgggc
cgcctgcgcgcctacctgctgcacggaccgtccgcgtcaggaaatgccagtgagtcagaa
gaagaacacagtgctgggagcacggaaaaccaagagctccccagcacacaccgggtgcca
gactccaaattccataccctccacaccaagatagacgtcatcaagaaagggcacgccaag
gacagccagcgctacaaagtagactacgagtctcagagcacagacacccagaacttctcc
tctgagtccaaacaggaaacagaatacggcccttgccgcagggaaatggaggacacgctg
aaccacctcaagttcctcaacgtgctgagccccagaggcgtgcacattcctaactgtgac
aagaagggcttttataagaaaaagcagtgccgcccttccaaaggcaggaagcgaggcttc
tgctggtgtgtggacaagtacgggcagcctctcccaggctacgacaccaaggggaaaggt
gacatccactgctacaacatggagagcaagtaa

DBGET integrated database retrieval system