KEGG   Loxodonta africana (African savanna elephant): 100675020
Entry
100675020         CDS       T04351                                 

Gene name
PLIN1
Definition
(RefSeq) LOW QUALITY PROTEIN: perilipin-1
  KO
K08768  perilipin-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04371  Apelin signaling pathway
lav04714  Thermogenesis
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100675020 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100675020 (PLIN1)
   03320 PPAR signaling pathway
    100675020 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100675020 (PLIN1)
SSDB
Motif
Pfam: Perilipin LIN37 DUF4660
Other DBs
NCBI-GeneID: 100675020
NCBI-ProteinID: XP_003413939
LinkDB
Position
Unknown
AA seq 515 aa
MAVNKSPTMLDEDLPEKENVIQRVLQLPVVSGTCECFQKTYASTKESHPLVASVCNAYEK
GVQGASNLAAWSMEPVVRRLSTQFIAANDLACRGLDHLEEKIPALQYPPEKIASELKDTI
STRLRSARNSISVPITSTSDKVLGAALAGCELALGVAKDTAEFAANTRAGRLASGGADLA
LGGIEKMVEFLLPPAKEESASDPGCQWTQKKLPKGKPSLLSRVGALANTLSHHTFQTTAW
ALKQGTDMALWIPGVAPLSNLAQWGASAAMQAVSRQQSGVPWLHNIAITQEEDHNDQNDT
EGEETEEEEEEEEEKETEEKLSEVAALPSPKGLLGSVAHTMQMALQSSISAVTWAPATVL
GMAGRLLHLMPTRAVSSAKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRD
IDNPPAEAERRGSGARATGPECLPRPALYRSSLRNARGSARVRTTSSXRPPHRARAFPAV
PREKPTRRVSDSFFRPSVMEPILGRAQYGQLRKKS
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcagtcaacaagagtccgaccatgctggatgaagacctccccgaaaaggagaatgtg
atacagagggtcctgcagctgccggtggtgagtggtacctgtgagtgtttccagaagacc
tatgccagcaccaaggaatcccaccctttggtggcctctgtatgcaatgcctacgagaag
ggcgtgcagggcgccagcaacttggctgcctggagcatggagcctgtggtccgcaggctg
tccacccagttcatagctgccaacgacctggcctgccgaggcctggaccacctggaggaa
aagatcccagcgctccagtaccctcctgaaaagatcgcctccgagctgaaggacaccatc
tccacccgccttcgcagtgccaggaacagtatcagcgtgcccatcacaagcacttcagac
aaggtcctgggggccgctctggccggctgtgagcttgccttgggagtggccaaagacacg
gccgaatttgccgccaacactcgagctggtcggctggcctctggaggggctgacctggcc
ctgggcggcattgaaaagatggtggagttcctccttcctccagccaaggaagagtcagcc
tctgatcctggatgccagtggacccaaaagaagcttcccaagggcaagccgagcctcctg
agcagggttggggcactggccaacaccttgtctcatcacaccttccagaccacagcctgg
gcactgaagcagggcactgacatggccctgtggatcccaggtgtggcacccctgagcaac
ctggcccagtggggtgcatcagcagccatgcaggcagtgtcccggcagcagagtggggtg
ccctggttacacaacatcgccatcacccaggaggaggaccacaatgaccagaatgacaca
gagggggaggagacggaggaggaggaggaggaagaggaagagaaggagaccgaagagaag
ctcagtgaggtggcagccctgcccagcccaaaaggcctcctgggcagtgtggcacacact
atgcagatggccctccagagctccatctcggctgtgacatgggcacctgccactgtgctg
ggcatggcggggagactgctgcacctcatgcccacccgtgctgtctcctcggccaagggg
agggccatgtccctgtcggacgccctgaagggtgttactgacaacgtggtggacacggtg
gtgcactacgtgccgctccctaggctgtcgctgatggaacccgaaagcgaattccgtgac
atcgacaacccaccagccgaggccgagcgccgaggctctggggcccgggccactggccca
gagtgcttgccacgcccagctctgtatcgcagcagcctgcgcaacgcgcgtggctcggcc
cgagtcaggacgacaagctcgtgacgcccgccgcaccgagcccgggcttttccggccgtg
cctcgcgagaagcccactcgcagggtcagcgacagcttcttccggcccagcgtcatggag
cccatcctgggccgcgctcaatatggccagctgcgcaagaagagctga

DBGET integrated database retrieval system