KEGG   Loxodonta africana (African savanna elephant): 100675032Help
Entry
100675032         CDS       T04351                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha
  KO
K04383  interleukin 1 alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04217  Necroptosis
lav04218  Cellular senescence
lav04380  Osteoclast differentiation
lav04640  Hematopoietic cell lineage
lav04932  Non-alcoholic fatty liver disease (NAFLD)
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04940  Type I diabetes mellitus
lav05020  Prion diseases
lav05133  Pertussis
lav05140  Leishmaniasis
lav05152  Tuberculosis
lav05162  Measles
lav05164  Influenza A
lav05321  Inflammatory bowel disease (IBD)
lav05323  Rheumatoid arthritis
lav05332  Graft-versus-host disease
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675032 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100675032 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100675032 (IL1A)
   04218 Cellular senescence
    100675032 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100675032 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100675032 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100675032 (IL1A)
   05321 Inflammatory bowel disease (IBD)
    100675032 (IL1A)
   05332 Graft-versus-host disease
    100675032 (IL1A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100675032 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100675032 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100675032 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100675032 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100675032 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100675032 (IL1A)
   05152 Tuberculosis
    100675032 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    100675032 (IL1A)
   05164 Influenza A
    100675032 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100675032 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100675032 (IL1A)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interleukins
   100675032 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1_propep IL1
Motif
Other DBs
NCBI-GeneID: 100675032
NCBI-ProteinID: XP_003417445
UniProt: G3SN89
LinkDB All DBs
Position
Unknown
AA seq 268 aa AA seqDB search
MAKVPDLFEDLKDCYSENEEYSSNNDTLSLIQKSFYDANYGPLQEVCMDKFMSLSTSETS
KIAKPAFKESVAVVSATGKILKKRRLSLNQPITDEDLEAIANDPEEEIIESKSAFSTFQN
KVKYGFTKTIKSQCILNDILAQSLIRDPTGPYLKAAALNNLDNAVKFDIGAYKPADGFNI
PVTLRISKTRLFVSAQDEGEPLLLKEMPETPKVIIDETNLLFLWENHGIMHYFRSMAHPE
LFIATKNEERVHLARGQPSTIDFKIWDN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttcctgacctgtttgaagacctgaaggactgttacagtgaaaatgaagaa
tacagttccaacaatgacaccctctctctgattcagaaatccttctatgatgcaaactat
ggcccacttcaggaggtctgcatggataaatttatgtcactgagtacctctgaaacctct
aagatagccaaacctgccttcaaggagagtgtggcagtggtgtcagccacagggaagatt
ctgaagaaaagacgactaagtttaaatcagcccatcactgatgaagacctggaggccatt
gccaatgatccagaagaagaaatcatcgagagcaaatcagcattttccaccttccagaac
aaagtgaaatacggctttacaaagaccatcaaaagccagtgcatcctgaacgacatcctt
gctcaaagtttaattcgagacccaacaggtccatacctcaaggctgctgctttaaataac
ctggacaatgcagtgaaatttgacataggtgcttataaaccagcagatggttttaacatt
cccgtgactctaagaatctcaaaaactcgactatttgtgagtgcccaagacgaaggtgaa
ccgctgttgctgaaggagatgcctgagacacccaaagtcatcatagatgagaccaacctc
ctcttcctgtgggaaaaccatggtattatgcactacttcagatcaatggcccatccagag
ttgtttattgccacaaagaatgaagaacgtgtacacctggcaagagggcaaccctctacc
attgacttcaagatatgggataactag

DBGET integrated database retrieval system