KEGG   Loxodonta africana (African savanna elephant): 100675066
Entry
100675066         CDS       T04351                                 

Gene name
VDR
Definition
(RefSeq) vitamin D3 receptor isoform X2
  KO
K08539  vitamin D3 receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04978  Mineral absorption
lav05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100675066 (VDR)
  09154 Digestive system
   04978 Mineral absorption
    100675066 (VDR)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100675066 (VDR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100675066 (VDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100675066 (VDR)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100675066 (VDR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100675066 (VDR)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100675066 (VDR)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100675066 (VDR)
Nuclear receptors [BR:lav03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   100675066 (VDR)
SSDB
Motif
Pfam: zf-C4 Hormone_recep zf-RRPl_C4
Other DBs
NCBI-GeneID: 100675066
NCBI-ProteinID: XP_003405789
UniProt: G3SY52
LinkDB
Position
Unknown
AA seq 424 aa
MEAMAASTSLPDPGDFDQNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIITILLEAHHKTYDPTYADFTQFRPPVHGVEGGGSHPSSSSLHTPSFSGE
SSSSDHYTTSADMMEPSSFSNLDLKEGDSDDPSETLDLSQLSMLPHLADLVSYSIQKVIG
FAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGSEDYKYRVSDVTKA
GHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTL
QTYIRCRHPPPGGHLLYAKMIQKLADLRSLNEEHSKQYRCLSFHPECSMKLTPLLMEVFG
NELS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaggcgatggcagccagcacttccctgcctgaccctggcgactttgatcagaatgtg
ccccggatctgtggggtatgtggagaccgagccacaggctttcattttaacgctatgacc
tgtgaaggctgcaaaggtttcttcaggcgaagcatgaagcggaaggcgctgttcacctgt
cccttcaacggagactgccgcatcaccaaggacaaccgacgccactgccaggcctgccga
ctcaagcgctgcgtggacattggcatgatgaaggagttcatcttgacagacgaggaggtg
cagcggaagcgggagatgatcctgaagcggaaggaggaggaagccttgaaggacagcctg
cggcccaagctgtctgaggagcagcagcgcatcattaccatcctgctagaagcccaccat
aagacctacgaccccacctatgccgacttcacccagttccggcctccagttcacggtgtt
gagggtggagggagccatccctcaagctcctcactgcacacacccagcttctctggggaa
tcctcctcctcagatcactacacaacctctgcagacatgatggagccatccagtttctcc
aacctggacctgaaagaaggcgactctgacgacccttctgagactttagacctgtcccag
ctctccatgctaccccacctggctgacctggtcagttacagcatccagaaggtcattggc
tttgccaagatgataccaggattcagagacctcacctctgaggaccagatcgtgctgctg
aagtcaagtgccattgaggtcatcatgttgcgctccaatgagtccttcaccatggacgac
atgtcctggacctgtggcagcgaggactacaagtaccgtgtcagtgatgtaaccaaagct
ggacacagcttggagctgatcgagcccctcatcaagttccaggtgggactaaagaagctg
aacttgcatgaggaagagcatgtcctgctcatggccatctgcattgtctctccagaccgc
cctggggtgcaggacgctgcactcatcgaggccatccaggaccgcctgtccaacacgctg
cagacctacatccgctgccgccacccacccccaggcggccacctcctctacgccaagatg
atccagaagctggccgacctgcgcagcctcaatgaggagcactccaagcagtaccgctgc
ctctccttccatcccgagtgcagcatgaagctcacgcccctcctgatggaggtgtttggc
aatgagctctcctga

DBGET integrated database retrieval system