KEGG   Loxodonta africana (African savanna elephant): 100675124
Entry
100675124         CDS       T04351                                 

Gene name
BCAR1
Definition
(RefSeq) LOW QUALITY PROTEIN: breast cancer anti-estrogen resistance protein 1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04510  Focal adhesion
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav04935  Growth hormone synthesis, secretion and action
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100675124 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675124 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100675124 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100675124 (BCAR1)
   04062 Chemokine signaling pathway
    100675124 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100675124 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100675124 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    100675124 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100675124 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 100675124
NCBI-ProteinID: XP_010595137
LinkDB
Position
Unknown
AA seq 869 aa
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPSGPGSGLPTTPAQPILHAAVMPPASQYTPMLPATYQSPPDNVYLVPTPG
KAQHGLYQAPGPSPQFQSPPAKQTSTFSKQTPHHPFPGPAPDLYQVPPGPGSPAQDIYQV
PPSAGMGHDIYQVPPSMDMRSWEGTKPPAKVVVPTRVGQGYVYEASQPEQDEYDIPRHLL
APGPQDIYDVPPVRGLLPSQYSQEVYDTPPMAVKGPNGRDPSLDVYDVPPSVEKGLLPPS
HHMVYDVPPSVSKDMPDGALLREETYDVPPAFAKAKPFDPARHPLVLAAPPPDPPPAEDV
YDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADSSTADDGVYAVPPSTEREAP
ADAKRLSASSTGSTRSSQSVSSLETAVPGREPLELEVAVEALARLQQGVSATVAHLLDLV
GSTGGGGGGRSTSEPQEPPMQDLRAAAAAVQGAVHELLEFARSAIGNAAHTSDRTLHAKL
SRQLQKMEDVHQTLVAHGQALDSGRGGSGATSEDLDRLVACSRAVPEDAKQLASFLHGNA
SLLFRRTKAPAPGPEGGGPLHPNPADKACSIQSRPLPSPPKFTSQDSPDGQYENSEGGWM
EDYDYVHLQGKEEFEKTQKELLEKDSIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLAN
WTPTQPLVPGRTGSLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAH
SKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPA
AAQDMVDRVKELGHSTQQFRRVLGQLAAA
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgtccgtgccgaatgtgctggccaaagccctctatgacaacgtggccgagtccccagac
gagctctccttccgcaagggcgacatcatgacggtgctagagcgggacacacagggcctg
gatggctggtggctctgctcactgcatggacgccaaggcatcgtgcccgggaaccgcctc
aagatcctggtgggcatgtatgacaagaagccatccgggcctggctctggtctgcccacc
accccagcccagcccatcctccatgccgctgtgatgcccccggcctcccagtatacaccc
atgctccctgccacataccagtccccgccagacaatgtctacctggtgcccaccccaggc
aaggctcagcacggcctctaccaagcccctgggcccagcccacagttccagtcacccccg
gccaagcagacgtccacgttctcaaagcaaacaccccatcacccgtttcccggcccggcc
ccagacctctaccaggtgcccccagggcctggcagccctgcccaggacatttaccaggtg
ccgccttcagctggaatggggcatgacatctaccaggtccccccatccatggacatgcgc
agctgggaggggacaaagccaccagcaaaggtggtggtacccacccgcgtggggcagggc
tatgtgtacgaggcctcccagccagagcaggatgagtatgacataccgcgccacttgttg
gccccagggccccaggacatctatgacgtgccacctgtgcgaggactgcttcccagccag
tatagccaggaggtgtatgacacacccccgatggctgtcaagggccccaatggccgggac
ccatcgctggatgtgtatgacgtgccccccagcgtggagaagggcctgctaccgcccagc
caccacatggtgtatgatgttcctccatcggtgagcaaggacatgcctgacggtgcactg
ctgcgtgaggaaacgtatgacgtgccccccgccttcgccaaggccaaaccctttgaccca
gcccgccacccactggttcttgctgcaccccctcctgacccgccgccggccgaggatgtg
tacgacgtgccccctcctgctcctgacctctacgatgtgcctcctggcctgcggcggcct
ggccctggcaccctctacgacgtgccccgtgagcgggtacttccacctgaggtggccgac
agcagtacggccgacgatggtgtgtacgcagtacccccctcaactgagcgcgaggcccca
gctgacgccaagcgcctatcagcctcaagcacgggcagcacgcgaagcagccagtccgtg
tcctccctggagacagcggtgccgggccgtgagccactggagctggaggtcgccgtggag
gctctggctcgactgcaacagggtgtgagtgccactgtggcccacctcctggacctggtg
ggcagcacaggtgggggtgggggcgggcgcagcacctccgagcctcaggagccccccatg
caagacctgcgagctgctgcggccgctgtccaaggggccgtacatgagctgctagagttc
gcccgcagcgccatcggcaatgctgcccatacttccgaccgtaccctgcacgccaagctc
agtcggcagctgcagaagatggaggatgtgcaccagacactggtggcacatggccaggcc
ctcgacagtggccggggaggctcgggggccacttctgaggacctagaccgcttggtggcc
tgctcacgggctgtacctgaggacgccaagcagctagcctccttcttgcatggcaatgcc
tcactgctcttcagaaggaccaaggcccctgctccggggcctgaggggggcggccccctg
catcccaaccctgccgacaaggcctgcagcatccagtcacggcctctgccctcacccccc
aagtttacctcccaggactcgccagatgggcagtatgagaacagcgaggggggctggatg
gaggattatgactacgtccacctacaggggaaggaagagtttgagaagacacagaaggag
ctgctggagaaggacagcatcatgcggcaggggaaaggccagctggaactgcagcagctg
aagcagtttgagcgactggagcaagaagtatcgcggcccattgaccacgacctggccaac
tggacacctacccagcccctggtcccagggcggacaggcagcctggggccctccgaccgg
cagctgctgctcttctacctggaacagtgtgaggcaaacctgaccacactgaccaacgca
gtcgacgccttctttaccgccgtggccaccaaccagccgcccaagatctttgtggcacac
agcaagttcgtcattctcagtgcccacaagctagtgttcattggggacacactctcgcgg
caggccaaggcggctgacgtgcgtagccaggtgacccactatagcaacctgctgtgtgac
ctcctacgtggcatcgtggctaccaccaaggccgctgccctgcagtacccgtcacctgct
gccgcccaggacatggtggacagggtcaaggagctaggccacagcacccaacagtttcgc
cgggtcctgggccagttggcagctgcctaa

DBGET integrated database retrieval system