KEGG   Loxodonta africana (African savanna elephant): 100675144
Entry
100675144         CDS       T04351                                 

Gene name
CTGF
Definition
(RefSeq) connective tissue growth factor
  KO
K06827  connective tissue growth factor (insulin-like growth factor-binding protein 8)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04371  Apelin signaling pathway
lav04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100675144 (CTGF)
   04371 Apelin signaling pathway
    100675144 (CTGF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100675144 (CTGF)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    100675144 (CTGF)
SSDB
Motif
Pfam: TSP1_CCN Cys_knot VWC IGFBP TSP_1
Other DBs
NCBI-GeneID: 100675144
NCBI-ProteinID: XP_023402841
LinkDB
Position
Unknown
AA seq 443 aa
KPGPPAPASHNNSCLLRGACQSNSIHGPQTTDRLQLDGIHPGRQHPTRQPARRVQAPTSG
ESPRQTSPPTASARPAAAPPRSEPRPAPCEAPDHVRRPAWAPSASSWRSLLALCSRTASS
QDCSGQCQCAAAPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGS
PVNRKIGVCTAKDGAPCVFGGTVYRSGESFQSSCKYQCTCLDGAVGCVPLCSMDVRLPSP
DCPFPRRVKLPGKCCEEWVCDEPKDHTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEW
SACSKTCGMGISTRVTNDNTFCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPV
KFELSGCTSVKSYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKSMMFIKTCACH
YNCPGDNDIFESLYYKKMYGDMA
NT seq 1332 nt   +upstreamnt  +downstreamnt
aagcctgggccgcccgccccagcctcacacaacaactcttgcctgctgagaggagcctgc
cagagcaactccatccacgggccacagaccaccgaccgcctccagctcgacgggatccac
cccggccgacagcacccgacacgacagccagcccggcgcgtccaggcacccacctccggc
gaaagtccgcggcagacctccccgccgaccgccagcgcccgccccgccgcagccccgccg
cgctccgagcctcggcccgctccttgcgaagcacccgaccatgtccgccgcccggcttgg
gctccgtccgcttcgtcttggcgctccctgctcgccctctgcagccggacggcttccagc
caggactgcagcgggcagtgccagtgtgcggccgcgccggcgccgcggtgcccggcaggc
gtcagcctggtgctggacggctgcggctgctgccgcgtatgcgccaaacaactgggcgag
ctgtgcactgagcgcgacccctgcgacccgcacaagggcctcttctgcgactttggctcc
ccggtcaaccgcaagatcggcgtgtgcaccgctaaagatggtgccccctgcgtctttgga
ggaacagtgtaccggagcggggagtccttccagagcagctgcaaataccagtgcacttgt
ctggacggggctgtgggctgcgtgcccttgtgcagcatggacgttcgcctacccagcccg
gactgccccttcccccggagggtcaagctgcccgggaaatgctgcgaggagtgggtgtgc
gacgagcccaaggaccacactgtggttggccctgccctcgccgcttaccgactggaagac
acgtttggcccagacccaacaatgattcgagccaactgcctcgtccagaccacagagtgg
agcgcctgttccaagacctgtgggatgggcatctccactcgagttaccaatgacaacacc
ttctgcaggctggagaagcagagccgcctctgcatggtcaggccttgcgaagctgacctg
gaagagaacattaagaagggcaaaaagtgcatccgtacccccaaaatctccaagcctgtc
aagtttgagctctctggctgcaccagtgtgaagagctaccgggccaagttctgtggagtg
tgcaccgatggtcgatgctgcaccccccacagaaccaccacccttccggtggagttcaag
tgtcctgatggtgaggtcatgaagaagagcatgatgttcatcaagacctgtgcctgccat
tacaactgccctggagacaatgacatcttcgaatcgctgtactacaagaagatgtatgga
gacatggcataa

DBGET integrated database retrieval system